Name:& &Date:& &Block:& & & &
|
|
- Randolf Lawson
- 5 years ago
- Views:
Transcription
1 Name: Date: Block: Advanced(Math(Mid-Term(Review((short)( ( Evaluatethefollowingexpressionsusingthetrianglegivenbelow.Expressanswers insimplifiedfractionalform.(nosquarerootsinthedenominator) 1. ( ( Solvefortheindicatedvariable(s)onthefollowingtriangles.Showallworkand roundanswerstothreedecimalplaces. 2. x= y=
2 3.Find w, x, y, and z. 4. Solve for w, x, y, and z. 5. Solve for x and y.
3 6.Find the missing sides and/or angles using special right triangles a. b. 7.Aladderofunknownlengthisleaningagainstawall.Iftheladderreaches10feet upthewallandtheangleformedbetweenthegroundandtheladderis57degrees, thenhowlongistheladder? Sketch: Answer:
4 8.Sketchtheangleandthendeterminethereferenceangle a.θ = 510 b.θ = 14π 5 9.DetermineifthefollowingtwoanglesarecoRterminal a. 23 and 743 b. 5π 6 and π 6 10.Convertthefollowinganglesfromdegreestoradiansorradianstodegrees 5π a. 200 b. 12 c radians
5 11. Given the terminal side of θ intersects ( 4, 2) (hint:makeadrawing!) a.findtheangleθ b.findthereferenceangleforθ c.evaluateθforallsixtrigfunctions sin(θ)= cos(θ)= tan(θ)= csc(θ)= sec(θ)= cot(θ)= 12.If tan(θ) = 2 and θ is in Q3 5 a.findtheangleθ b.findthereferenceangleforθ c.evaluateθforallsixtrigfunctions sin(θ)= cos(θ)= tan(θ)= csc(θ)= sec(θ)= cot(θ)=
6 13.If csc(θ) = 7 and θ is in Q4 3 a.findtheangleθ b.findthereferenceangleforθ c.evaluateθforallsixtrigfunctions sin(θ)= cos(θ)= tan(θ)= csc(θ)= sec(θ)= cot(θ)= 14.Name the quadrant that satisfies each piece of information. a. sec(a) is negative, sin(a) is positive b. sec(b) is positive, tan(b) is negative 15.Evaluatethefollowingexpressionsexactly;leaveanswersinsimplifiedradical form. a. tan( 60 ) b. csc 405 ( ) c. cos 17π 6
7 Identifythetransformationsforthefollowingtrigonometricfunctions: Graphthefollowingequation(indegrees)Be(sure(to(label(the(x(and(y(axis( 16. f (x) = sin 2 x 45 ( ( )) + 3 Amplitude: Period: Interval: Frequency(b): Phase/HorizontalShift: VerticalShift: Graphthefollowingequation(indegrees)Be(sure(to(label(the(x(and(y(axis( 17. f (x) = 2cos 1 ( 2 x +180) 3 Amplitude: Period: Interval: Frequency(b): Phase/HorizontalShift: VerticalShift:
8 Graphthefollowingequation(inradians)Be(sure(to(label(the(x(and(y(axis( 18. f (x) = 2sin 1 ( 2 x π ) +1 Amplitude: Period: Interval: Frequency(b): Phase/HorizontalShift: VerticalShift: Graphthefollowingequation(inradians)Be(sure(to(label(the(x(and(y(axis( 19. f (x) = 4cos 2 x π 4 Amplitude: Period: Interval: Frequency(b): Phase/HorizontalShift: VerticalShift:
9 Directions:Writethesin(x)andcos(x)equationsofthegraphsdepictedinthe questionsbelow;showallworktofindallcoefficients: 20. Amplitude (a) = Frequency (b) = Period (2pi / b) = Vertical Shift (d) = HorizontalshiftforSine= cforsine= HorizontalshiftforCosine= cforcosine= sin(x): cos(x):
10 Note:thex axisscaleforthisgraphis90degrees!(doworkindegreesthistime) 21. Amplitude (a) = Frequency (b) = Period (360 / b) = Vertical Shift (d) = HorizontalshiftforSine= cforsine= HorizontalshiftforCosine= cforcosine= sin(x): cos(x):
11 22.Thedepthofwaterattheendofapiervariessinusoidallywiththetides throughouttheday.todaythefirstlowtideoccursat2amwithadepthof6feet. Thefirsthightideoccursat10AMwithadepthof16feet. Let12AMrepresenttime=0 Sketchagraphandwritetheequationthatmodelsthesituation(picksinorcos)!!!! Amp: Period: Interval: phase: vert: A= B= C(forsin)= C(forcos)= D= intermsofsin(x): orcos(x): Atwhattime(s)willtheheightofthewaterbe12feet?
12 23. A weight attached to the end of a long spring is bouncing up and down. As it bounces, its distance from the ground varies sinusoidally with time. You start a stopwatch. When the stopwatch reads 1.1 seconds the weight reaches a minimum point of 20 cm above the floor. This minimum point is followed by a maximum point of 80 cm above the floor at a time of 1.9 seconds. Amp: Period: Interval: phase: vert: A= B= C(forsin)= C(forcos)= D= intermsofsin(x): orcos(x): Atwhattime(s)willtheweightbe30cmabovethefloor?
13 24. Consider the equation: where y is height in cm and x is time in seconds. a. How far off the ground is the weight when the stopwatch starts? b. How far off the ground is the weight after 5 seconds? c. How many seconds have passed when the weight is first 70 cm above the ground 25.Evaluatethefollowingexpressionswithoutacalculator;expressanswersin simplifiedfractionalform: a. cos 1 0 c. tan 1 3 ( ) b. sin ( ) d. tan 1 1 ( )
14 Solvethetrianglebelowforallmissingvalues;roundanswerstothreedecimal places;expressanglesindegreeform: Makeadrawingtorepresenteachproblembelowandthensolve;round answerstothreedecimalplacesandexpressanglesindegrees a.you are standing 50 feet from the base of a flag on a golf course. The flag is 8 feet tall. Find the angle of elevation to the top of the flag to the nearest tenth of a degree. b.you are standing on a roof of a factory and you are looking down at the base of a silo that is 70 feet away. The factory is 25 feet tall. Find the angle of depression.
15 28.Solvethefollowingequationsandlistallsolutions:(theyshouldbeunitcircle values!) a. sin x = 1 2 b. 2cos x = 2 c.3cot x = 3 d. e. 4cos 2 x +1 = 4 f. tan 2 x 2 = 1
16 29.Solvethefollowingequationsforallsolutionsbetween0and360;round answersto3decimalplaces:(feelfreetousetheblankunitcircletohelp!) a. 3cos x 2 = 0 b. sec x = 6.2 c. tan x = 11 9
17 30.Sketchandthensolvethefollowingtrianglesforallmissingsidesandangles; showallwork: a. In ABC, a = 114, <B=61º, and <C = 47º. b. In ABC, a = 4, <A=53.13º, and b = 5. c. In ABC, <B=20º, <C=50º, and c = 20.
18 d. In ABC, a=8, b=15, and c = 20. e. In ABC, a=12, b=10, and <C=78º. 31. In, e = 24, f = 8, E = 100, F = 20. What is the area of the triangle to the nearest tenth?
19 32.Thefollowingsidesandanglescanbedrawnas2/possible/triangles;drawboth trianglesandsolveforallmissingsidesandangles: AngleB=35 sidea=11 sideb=7 33.ProvethefollowingstatementsbyCLEARLYshowingeverystep a. b. c. d.
20 e. f. 34.Graph each polar coordinate and complete the equivalent coordinate. A (5, 165º) = ( 5, ) B ( 3, 270º) = ( 3, ) C (4, 60º) = (, 120º) D ( 2, 210º) = (, 330º)
21 35. Change from polar coordinates to rectangular coordinates. E ( 7, 270º) F ( 5, 235º) 36. Change from rectangular coordinates to polar coordinates. G ( 4 3, 4) H (9, -2)
HW. Pg. 334 #1-9, 11, 12 WS. A/ Angles in Standard Position: Terminology: Initial Arm. Terminal Arm. Co-Terminal Angles. Quadrants
MCR 3UI Introduction to Trig Functions Date: Lesson 6.1 A/ Angles in Standard Position: Terminology: Initial Arm HW. Pg. 334 #1-9, 11, 1 WS Terminal Arm Co-Terminal Angles Quadrants Related Acute Angles
More informationTrigonometry I. Exam 0
Trigonometry I Trigonometry Copyright I Standards 006, Test Barry Practice Mabillard. Exam 0 www.math0s.com 1. The minimum and the maximum of a trigonometric function are shown in the diagram. a) Write
More informationHW#50: Finish Evaluating Using Inverse Trig Functions (Packet p. 7) Solving Linear Equations (Packet p. 8) ALL
MATH 4R TRIGONOMETRY HOMEWORK NAME DATE HW#49: Inverse Trigonometric Functions (Packet pp. 5 6) ALL HW#50: Finish Evaluating Using Inverse Trig Functions (Packet p. 7) Solving Linear Equations (Packet
More informationLesson 27: Angles in Standard Position
Lesson 27: Angles in Standard Position PreCalculus - Santowski PreCalculus - Santowski 1 QUIZ Draw the following angles in standard position 50 130 230 320 770-50 2 radians PreCalculus - Santowski 2 Fast
More informationPlane Trigonometry Test File Fall 2014
Plane Trigonometry Test File Fall 2014 Test #1 1.) Fill in the blanks in the two tables with the EXACT values (no calculator) of the given trigonometric functions. The total point value for the tables
More informationSec 4.1 Trigonometric Identities Basic Identities. Name: Reciprocal Identities:
Sec 4. Trigonometric Identities Basic Identities Name: Reciprocal Identities: Quotient Identities: sin csc cos sec csc sin sec cos sin tan cos cos cot sin tan cot cot tan Using the Reciprocal and Quotient
More informationPacket Unit 5 Trigonometry Honors Math 2 17
Packet Unit 5 Trigonometry Honors Math 2 17 Homework Day 12 Part 1 Cumulative Review of this unit Show ALL work for the following problems! Use separate paper, if needed. 1) If AC = 34, AB = 16, find sin
More informationMA 154 PRACTICE QUESTIONS FOR THE FINAL 11/ The angles with measures listed are all coterminal except: 5π B. A. 4
. If θ is in the second quadrant and sinθ =.6, find cosθ..7.... The angles with measures listed are all coterminal except: E. 6. The radian measure of an angle of is: 7. Use a calculator to find the sec
More informationObjective: Manipulate trigonometric properties to verify, prove, and understand trigonmetric relationships.
Objective: Manipulate trigonometric properties to verify, prove, and understand trigonmetric relationships. Apr 21 4:09 AM Warm-up: Determine the exact value of the following (without a calculator): sin
More informationHONORS PRECALCULUS Prove the following identities- x x= x x 1.) ( ) 2 2.) 4.) tan x 1 cos x 6.)
HONORS PRECALCULUS Prove the following identities- 1.) ( ) cosx sinx = 1 sinxcosx.) cos x tan x+ sec x= 1 sinx 3.) 1 + 1 = csc x 1 cos x 1+ cos x 4.) sec x + 1 sin x = tan x 1 cos x 5.) cot cos cos cot
More informationsin30 = sin60 = cos30 = cos60 = tan30 = tan60 =
Precalculus Notes Trig-Day 1 x Right Triangle 5 How do we find the hypotenuse? 1 sinθ = cosθ = tanθ = Reciprocals: Hint: Every function pair has a co in it. sinθ = cscθ = sinθ = cscθ = cosθ = secθ = cosθ
More informationLesson 5.6: Angles in Standard Position
Lesson 5.6: Angles in Standard Position IM3 - Santowski IM3 - Santowski 1 Fast Five Opening Exercises! Use your TI 84 calculator:! Evaluate sin(50 ) " illustrate with a diagram! Evaluate sin(130 ) " Q
More informationTrig/Math Anal Name No HW NO. SECTIONS ASSIGNMENT DUE TG 1. Practice Set J #1, 9*, 13, 17, 21, 22
Trig/Math Anal Name No LATE AND ABSENT HOMEWORK IS ACCEPTED UP TO THE TIME OF THE CHAPTER TEST ON NO GRAPHING CALCULATORS ALLOWED ON THIS TEST HW NO. SECTIONS ASSIGNMENT DUE TG (per & amp) Practice Set
More informationSemester Exam Review. 1. Give a real life example of a situation that can be modeled with a periodic function.
Trigonometry Semester Exam Review Name: 1. Give a real life example of a situation that can be modeled with a periodic function.. As a child goes up and down on a seesaw, his or her distance form the ground
More informationPLANE TRIGONOMETRY Exam I September 13, 2007
Name Rec. Instr. Rec. Time PLANE TRIGONOMETRY Exam I September 13, 2007 Page 1 Page 2 Page 3 Page 4 TOTAL (10 pts.) (30 pts.) (30 pts.) (30 pts.) (100 pts.) Below you will find 10 problems, each worth
More information1. Let be a point on the terminal side of θ. Find the 6 trig functions of θ. (Answers need not be rationalized). b. P 1,3. ( ) c. P 10, 6.
Q. Right Angle Trigonometry Trigonometry is an integral part of AP calculus. Students must know the basic trig function definitions in terms of opposite, adjacent and hypotenuse as well as the definitions
More information5.1 Angles & Their Measures. Measurement of angle is amount of rotation from initial side to terminal side. radians = 60 degrees
.1 Angles & Their Measures An angle is determined by rotating array at its endpoint. Starting side is initial ending side is terminal Endpoint of ray is the vertex of angle. Origin = vertex Standard Position:
More informationSection 7.1. Standard position- the vertex of the ray is at the origin and the initial side lies along the positive x-axis.
1 Section 7.1 I. Definitions Angle Formed by rotating a ray about its endpoint. Initial side Starting point of the ray. Terminal side- Position of the ray after rotation. Vertex of the angle- endpoint
More informationPre Calculus Worksheet: Fundamental Identities Day 1
Pre Calculus Worksheet: Fundamental Identities Day 1 Use the indicated strategy from your notes to simplify each expression. Each section may use the indicated strategy AND those strategies before. Strategy
More informationReview of Trigonometry
Worksheet 8 Properties of Trigonometric Functions Section Review of Trigonometry This section reviews some of the material covered in Worksheets 8, and The reader should be familiar with the trig ratios,
More informationWarm-Up: Final Review #1. A rectangular pen is made from 80 feet of fencing. What is the maximum area the pen can be?
Warm-Up: Final Review #1 A rectangular pen is made from 80 feet of fencing. What is the maximum area the pen can be? Warm-Up: Final Review #2 1) Find distance (-2, 4) (6, -3) 2) Find roots y = x 4-6x 2
More informationMTH 112: Elementary Functions
6.2: Right triangle trigonometry 1/16 Figure: Euclid of Alexandria was a Greek mathematician, often referred to as the Father of Geometry 6.2: Right triangle trigonometry 2/16 6.2: Right triangle trigonometry
More informationTrigonometry LESSON FIVE - Trigonometric Equations Lesson Notes
Example Find all angles in the domain 0 θ that satisfy the given equation. Write the general solution. Primary Ratios Solving equations with the unit circle. a) b) c) 0 d) tan θ = www.math0.ca a) Example
More informationTrigonometry I -- Answers -- Trigonometry I Diploma Practice Exam - ANSWERS 1
Trigonometry I -- Answers -- Trigonometry I Diploma Practice Exam - ANSWERS www.puremath.com Formulas These are the formulas for Trig I you will be given on your diploma. a rθ sinθ cosθ tan θ cotθ cosθ
More informationCheckpoint 1 Define Trig Functions Solve each right triangle by finding all missing sides and angles, round to four decimal places
Checkpoint 1 Define Trig Functions Solve each right triangle by finding all missing sides and angles, round to four decimal places. 1.. B P 10 8 Q R A C. Find the measure of A and the length of side a..
More informationPre-Calc Unit 14: Polar Assignment Sheet April 27 th to May 7 th 2015
Pre-Calc Unit 14: Polar Assignment Sheet April 27 th to May 7 th 2015 Date Objective/ Topic Assignment Did it Monday Polar Discovery Activity pp. 4-5 April 27 th Tuesday April 28 th Converting between
More informationYoungstown State University Trigonometry Final Exam Review (Math 1511)
Youngstown State University Trigonometry Final Exam Review (Math 1511) 1. Convert each angle measure to decimal degree form. (Round your answers to thousandths place). a) 75 54 30" b) 145 18". Convert
More information1.6 Applying Trig Functions to Angles of Rotation
wwwck1org Chapter 1 Right Triangles and an Introduction to Trigonometry 16 Applying Trig Functions to Angles of Rotation Learning Objectives Find the values of the six trigonometric functions for angles
More informationPRECALCULUS MATH Trigonometry 9-12
1. Find angle measurements in degrees and radians based on the unit circle. 1. Students understand the notion of angle and how to measure it, both in degrees and radians. They can convert between degrees
More informationPre-Calc Trig ~1~ NJCTL.org. Unit Circle Class Work Find the exact value of the given expression. 7. Given the terminal point ( 3, 2 10.
Unit Circle Class Work Find the exact value of the given expression.. cos π. tan 5π 6. sin 7π 5. cot 5π. sec π 6. csc 9π 7. Given the terminal point (, 0 ) find tanθ 7 tan θ = 0 7 8. Given the terminal
More informationMULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question.
Exam Name MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question. Convert the angle to decimal degrees and round to the nearest hundredth of a degree. 1)
More informationMath 1330 Test 3 Review Sections , 5.1a, ; Know all formulas, properties, graphs, etc!
Math 1330 Test 3 Review Sections 4.1 4.3, 5.1a, 5. 5.4; Know all formulas, properties, graphs, etc! 1. Similar to a Free Response! Triangle ABC has right angle C, with AB = 9 and AC = 4. a. Draw and label
More informationMATH EXAM 1 - SPRING 2018 SOLUTION
MATH 140 - EXAM 1 - SPRING 018 SOLUTION 8 February 018 Instructor: Tom Cuchta Instructions: Show all work, clearly and in order, if you want to get full credit. If you claim something is true you must
More informationCommon Core Standards Addressed in this Resource
Common Core Standards Addressed in this Resource N-CN.4 - Represent complex numbers on the complex plane in rectangular and polar form (including real and imaginary numbers), and explain why the rectangular
More informationFind the amplitude, period, and phase shift, and vertical translation of the following: 5. ( ) 6. ( )
1. Fill in the blanks in the following table using exact values. Reference Angle sin cos tan 11 6 225 2. Find the exact values of x that satisfy the given condition. a) cos x 1, 0 x 6 b) cos x 0, x 2 3.
More informationChapter 3. Radian Measure and the Unit Circle. For exercises 23 28, answers may vary
Chapter Radian Measure and the Unit Circle Section....... 7. 8. 9. 0...... 7 8. 7. 0 8. 0 9. 0 0... 0 Radian Measure For exercises 8, answers may vary.. Multiply the degree measure by radian 80 and reduce.
More informationMULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question.
Precalculus CP Final Exam Review - 01 Name Date: / / MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question. Convert the angle in degrees to radians. Express
More informationMultiple Choice Questions Circle the letter of the correct answer. 7 points each. is:
This Math 114 final exam was administered in the Fall of 008. This is a sample final exam. The problems are not exhaustive. Be prepared for ALL CONCEPTS for the actual final exam. Multiple Choice Questions
More informationDate Lesson Text TOPIC Homework. Getting Started Pg. 314 # 1-7. Radian Measure and Special Angles Sine and Cosine CAST
UNIT 5 TRIGONOMETRIC FUNCTIONS Date Lesson Text TOPIC Homework Oct. 0 5.0 (50).0 Getting Started Pg. # - 7 Nov. 5. (5). Radian Measure Angular Velocit Pg. 0 # ( 9)doso,,, a Nov. 5 Nov. 5. (5) 5. (5)..
More informationLesson 26 - Review of Right Triangle Trigonometry
Lesson 26 - Review of Right Triangle Trigonometry PreCalculus Santowski PreCalculus - Santowski 1 (A) Review of Right Triangle Trig Trigonometry is the study and solution of Triangles. Solving a triangle
More informationPresented, and Compiled, By. Bryan Grant. Jessie Ross
P a g e 1 Presented, and Compiled, By Bryan Grant Jessie Ross August 3 rd, 2016 P a g e 2 Day 1 Discovering Polar Graphs Days 1 & 2 Adapted from Nancy Stephenson - Clements High School, Sugar Land, Texas
More informationTriangle Trigonometry
Honors Finite/Brief: Trigonometry review notes packet Triangle Trigonometry Right Triangles All triangles (including non-right triangles) Law of Sines: a b c sin A sin B sin C Law of Cosines: a b c bccos
More information4.8. Solving Problems with Trigonometry. Copyright 2011 Pearson, Inc.
4.8 Solving Problems with Trigonometry Copyright 2011 Pearson, Inc. What you ll learn about More Right Triangle Problems Simple Harmonic Motion and why These problems illustrate some of the better- known
More informationUnit 7: Trigonometry Part 1
100 Unit 7: Trigonometry Part 1 Right Triangle Trigonometry Hypotenuse a) Sine sin( α ) = d) Cosecant csc( α ) = α Adjacent Opposite b) Cosine cos( α ) = e) Secant sec( α ) = c) Tangent f) Cotangent tan(
More informationLATE AND ABSENT HOMEWORK IS ACCEPTED UP TO THE TIME OF THE CHAPTER TEST ON
Trig/Math Anal Name No LATE AND ABSENT HOMEWORK IS ACCEPTED UP TO THE TIME OF THE CHAPTER TEST ON HW NO. SECTIONS ASSIGNMENT DUE TT 1 1 Practice Set D TT 1 6 TT 1 7 TT TT 1 8 & Application Problems 1 9
More informationSM 2. Date: Section: Objective: The Pythagorean Theorem: In a triangle, or
SM 2 Date: Section: Objective: The Pythagorean Theorem: In a triangle, or. It doesn t matter which leg is a and which leg is b. The hypotenuse is the side across from the right angle. To find the length
More informationName Trigonometric Functions 4.2H
TE-31 Name Trigonometric Functions 4.H Ready, Set, Go! Ready Topic: Even and odd functions The graphs of even and odd functions make it easy to identify the type of function. Even functions have a line
More informationTrigonometry. 9.1 Radian and Degree Measure
Trigonometry 9.1 Radian and Degree Measure Angle Measures I am aware of three ways to measure angles: degrees, radians, and gradians. In all cases, an angle in standard position has its vertex at the origin,
More informationMidterm Review January 2018 Honors Precalculus/Trigonometry
Midterm Review January 2018 Honors Precalculus/Trigonometry Use the triangle below to find the exact value of each of the trigonometric functions in questions 1 6. Make sure your answers are completely
More informationChapter TRIGONOMETRIC FUNCTIONS Section. Angles. (a) 0 (b) 0. (a) 0 (b) 0. (a) (b). (a) (b). (a) (b). (a) (b) 9. (a) 9 (b) 9. (a) 0 (b) 0 9. (a) 0 (b) 0 0. (a) 0 0 (b) 0 0. (a) 9 9 0 (b) 9 9 0. (a) 9 9
More information4.1 Angles and Angle Measure. 1, multiply by
4.1 Angles and Angle Measure Angles can be measured in degrees or radians. Angle measures without units are considered to be in radians. Radian: One radian is the measure of the central angle subtended
More informationReciprocal Identities Quotient Identities Pythagorean Identities
2 Precalculus Review Sheet 4.2 4.4 Fundamental Identities: Reciprocal Identities Quotient Identities Pythagorean Identities = csc! cos! = tan! sin2! + cos 2! = cos! = sec! cos! = cot! tan2! + = sec 2!
More information2. Determine the indicated angle. a) b) c) d) e) f)
U4L1 Review of Necessary Skills 1. Determine the length of x.. Determine the indicated angle. a) b) c) d) e) f) 3. From the top of a cliff 300m high, the angle of depression of a boat is o. Calculate the
More informationChapter 10 Homework: Parametric Equations and Polar Coordinates
Chapter 1 Homework: Parametric Equations and Polar Coordinates Name Homework 1.2 1. Consider the parametric equations x = t and y = 3 t. a. Construct a table of values for t =, 1, 2, 3, and 4 b. Plot the
More informationMathematics Placement Assessment
Mathematics Placement Assessment Courage, Humility, and Largeness of Heart Oldfields School Thank you for taking the time to complete this form accurately prior to returning this mathematics placement
More informationTrigonometry Winter E.C. Packet
Name: Class: Date: Trigonometry Winter E.C. Packet 1. *MUST SHOW WORK/COMPUTATION for all problems (these problems are designed to not to use a calculator except for Law of Sines/Cosines) *All work must
More informationDAY 1 - GEOMETRY FLASHBACK
DAY 1 - GEOMETRY FLASHBACK Sine Opposite Hypotenuse Cosine Adjacent Hypotenuse sin θ = opp. hyp. cos θ = adj. hyp. tan θ = opp. adj. Tangent Opposite Adjacent a 2 + b 2 = c 2 csc θ = hyp. opp. sec θ =
More informationTrigonometric ratios provide relationships between the sides and angles of a right angle triangle. The three most commonly used ratios are:
TRIGONOMETRY TRIGONOMETRIC RATIOS If one of the angles of a triangle is 90º (a right angle), the triangle is called a right angled triangle. We indicate the 90º (right) angle by placing a box in its corner.)
More informationMath12 Pre-Calc Review - Trig
Math1 Pre-Calc Review - Trig Multiple Choice Identify the choice that best completes the statement or answers the question. 1. Which of the following angles, in degrees, is coterminal with, but not equal
More informationCLEP Pre-Calculus. Section 1: Time 30 Minutes 50 Questions. 1. According to the tables for f(x) and g(x) below, what is the value of [f + g]( 1)?
CLEP Pre-Calculus Section : Time 0 Minutes 50 Questions For each question below, choose the best answer from the choices given. An online graphing calculator (non-cas) is allowed to be used for this section..
More information8-1 Simple Trigonometric Equations. Objective: To solve simple Trigonometric Equations and apply them
Warm Up Use your knowledge of UC to find at least one value for q. 1) sin θ = 1 2 2) cos θ = 3 2 3) tan θ = 1 State as many angles as you can that are referenced by each: 1) 30 2) π 3 3) 0.65 radians Useful
More informationPrecalculus CP Final Exam Review. MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question.
Precalculus CP Final Eam Review Name Date: / / MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question. Convert the angle in degrees to radians. Epress answer
More informationPART I You must complete this portion of the test without using a calculator. After you
Salt Lake Community College Math 1060 Final Exam A Fall Semester 2010 Name: Instructor: This Exam has three parts. Please read carefully the directions for each part. All problems are of equal point value.
More informationA lg e b ra II. Trig o n o m e tric F u n c tio
1 A lg e b ra II Trig o n o m e tric F u n c tio 2015-12-17 www.njctl.org 2 Trig Functions click on the topic to go to that section Radians & Degrees & Co-terminal angles Arc Length & Area of a Sector
More informationMCR3U UNIT #6: TRIGONOMETRY
MCR3U UNIT #6: TRIGONOMETRY SECTION PAGE NUMBERS HOMEWORK Prerequisite p. 0 - # 3 Skills 4. p. 8-9 #4, 5, 6, 7, 8, 9,, 4. p. 37 39 #bde, acd, 3, 4acde, 5, 6ace, 7, 8, 9, 0,, 4.3 p. 46-47 #aef,, 3, 4, 5defgh,
More informationMATH 1112 Trigonometry Final Exam Review
MATH 1112 Trigonometry Final Exam Review 1. Convert 105 to exact radian measure. 2. Convert 2 to radian measure to the nearest hundredth of a radian. 3. Find the length of the arc that subtends an central
More informationsin 2 2sin cos The formulas below are provided in the examination booklet. Trigonometric Identities: cos sin cos sin sin cos cos sin
The semester A eamination for Precalculus consists of two parts. Part 1 is selected response on which a calculator will not be allowed. Part is short answer on which a calculator will be allowed. Pages
More informationYou ll use the six trigonometric functions of an angle to do this. In some cases, you will be able to use properties of the = 46
Math 1330 Section 6.2 Section 7.1: Right-Triangle Applications In this section, we ll solve right triangles. In some problems you will be asked to find one or two specific pieces of information, but often
More informationMath 1330 Final Exam Review Covers all material covered in class this semester.
Math 1330 Final Exam Review Covers all material covered in class this semester. 1. Give an equation that could represent each graph. A. Recall: For other types of polynomials: End Behavior An even-degree
More informationMathematics for Computer Graphics. Trigonometry
Mathematics for Computer Graphics Trigonometry Trigonometry...????? The word trigonometry is derived from the ancient Greek language and means measurement of triangles. trigonon triangle + metron measure
More informationuntitled 1. Unless otherwise directed, answers to this question may be left in terms of π.
Name: ate:. Unless otherwise directed, answers to this question may be left in terms of π. a) Express in degrees an angle of π radians. b) Express in radians an angle of 660. c) rod, pivoted at one end,
More informationTrigonometry Review Day 1
Name Trigonometry Review Day 1 Algebra II Rotations and Angle Terminology II Terminal y I Positive angles rotate in a counterclockwise direction. Reference Ray Negative angles rotate in a clockwise direction.
More informationPre-calculus: 1st Semester Review Concepts Name: Date: Period:
Pre-calculus: 1st Semester Review Concepts Name: Date: Period: Problem numbers preceded by a $ are those similar to high miss questions on the Semester Final last year. You have multiple resources to study
More informationYou ll use the six trigonometric functions of an angle to do this. In some cases, you will be able to use properties of the = 46
Math 1330 Section 6.2 Section 7.1: Right-Triangle Applications In this section, we ll solve right triangles. In some problems you will be asked to find one or two specific pieces of information, but often
More informationTrigonometric Ratios and Functions
Algebra 2/Trig Unit 8 Notes Packet Name: Date: Period: # Trigonometric Ratios and Functions (1) Worksheet (Pythagorean Theorem and Special Right Triangles) (2) Worksheet (Special Right Triangles) (3) Page
More informationMid-Chapter Quiz: Lessons 9-1 through 9-3
Graph each point on a polar grid. 1. A( 2, 45 ) 3. Because = 45, locate the terminal side of a 45 angle with the polar axis as its initial side. Because r = 2, plot a point 2 units from the pole in the
More informationChapter 7: Analytic Trigonometry
Chapter 7: Analytic Trigonometry 7. Trigonometric Identities Below are the basic trig identities discussed in previous chapters. Reciprocal csc(x) sec(x) cot(x) sin(x) cos(x) tan(x) Quotient sin(x) cos(x)
More informationMath Analysis Final Exam Review. Chapter 1 Standards
Math Analysis Final Exam Review Chapter 1 Standards 1a 1b 1c 1d 1e 1f 1g Use the Pythagorean Theorem to find missing sides in a right triangle Use the sine, cosine, and tangent functions to find missing
More informationMathematics Placement Assessment. Courage, Humility, and Largeness of Heart. Grade Entering
Mathematics Placement Assessment Courage, Humility, and Largeness of Heart Oldfields School Thank you for taking the time to complete this form accurately prior to returning this mathematics placement
More informationTrigonometric Functions. Concept Category 3
Trigonometric Functions Concept Category 3 Goals 6 basic trig functions (geometry) Special triangles Inverse trig functions (to find the angles) Unit Circle: Trig identities a b c The Six Basic Trig functions
More informationThese are the type of problems that you will be working on in class. These problems are from Lesson 7.
Pre-Class Problems 10 for Wednesda, October 10 These are the tpe of problems that ou will be working on in class. These problems are from Lesson 7. Solution to Problems on the Pre-Eam. You can go to the
More informationExercise 1. Exercise 2. MAT 012 SS218 Worksheet 9 Sections Name: Consider the triangle drawn below. C. c a. A b
Consider the triangle drawn below. C Exercise 1 c a A b B 1. Suppose a = 5 and b = 12. Find c, and then find sin( A), cos( A), tan( A), sec( A), csc( A), and cot( A). 2. Now suppose a = 10 and b = 24.
More informationMAC Learning Objectives. Learning Objectives (Cont.) Module 2 Acute Angles and Right Triangles
MAC 1114 Module 2 Acute Angles and Right Triangles Learning Objectives Upon completing this module, you should be able to: 1. Express the trigonometric ratios in terms of the sides of the triangle given
More informationPART I: NO CALCULATOR (64 points)
Math 10 Trigonometry 11 th edition Lial, Hornsby, Schneider, and Daniels Practice Midterm (Ch. 1-) PART I: NO CALCULATOR (6 points) (.1,.,.,.) Match each graph with one of the basic circular functions
More information: Find the values of the six trigonometric functions for θ. Special Right Triangles:
ALGEBRA 2 CHAPTER 13 NOTES Section 13-1 Right Triangle Trig Understand and use trigonometric relationships of acute angles in triangles. 12.F.TF.3 CC.9- Determine side lengths of right triangles by using
More informationPart I. There are 5 problems in Part I, each worth 5 points. No partial credit will be given, so be careful. Circle the correct answer.
Math 109 Final Exam-Spring 016 Page 1 Part I. There are 5 problems in Part I, each worth 5 points. No partial credit will be given, so be careful. Circle the correct answer. 1) Determine an equivalent
More informationUnit 5 Day 5: Law of Sines and the Ambiguous Case
Unit 5 Day 5: Law of Sines and the Ambiguous Case Warm Up: Day 5 Draw a picture and solve. Label the picture with numbers and words including the angle of elevation/depression and height/length. 1. The
More informationPre-Calculus Right Triangle Trigonometry Review Name Dec π
Pre-Calculus Right Triangle Trigonometry Review Name Dec 201 Convert from Radians to Degrees, or Degrees to Radians 7π 1. 0 2.. 1. 11π. Find the si trig functions of θ. If sin θ =, find the other five
More informationis a plane curve and the equations are parametric equations for the curve, with parameter t.
MATH 2412 Sections 6.3, 6.4, and 6.5 Parametric Equations and Polar Coordinates. Plane Curves and Parametric Equations Suppose t is contained in some interval I of the real numbers, and = f( t), = gt (
More informationNational 5 Portfolio Relationships 1.5 Trig equations and Graphs
National 5 Portfolio Relationships 1.5 Trig equations and Graphs N5 Section A - Revision This section will help you revise previous learning which is required in this topic. R1 I can use Trigonometry in
More informationUnit O Student Success Sheet (SSS) Right Triangle Trigonometry (sections 4.3, 4.8)
Unit O Student Success Sheet (SSS) Right Triangle Trigonometry (sections 4.3, 4.8) Standards: Geom 19.0, Geom 20.0, Trig 7.0, Trig 8.0, Trig 12.0 Segerstrom High School -- Math Analysis Honors Name: Period:
More informationSHORT ANSWER. Write the word or phrase that best completes each statement or answers the question.
Review for Test 2 MATH 116 SHORT ANSWER. Write the word or phrase that best completes each statement or answers the question. Solve the right triangle. If two sides are given, give angles in degrees and
More informationI \ I I I MATH ANALYSIS I HONORS. REVIEW #I Chapters I and 2. l. Find the equation of the line parallel to 5x - 2y :6 with a y-intercept of 3.
MATH ANALYSS HONORS REVEW # Chapters and 2 l. Find the equation of the line parallel to 5x - 2y :6 with a y-intercept of 3. 2. Find the point of intersection betweenthe lines 2x-2y - -6 and 5x +y:21. 3.
More informationCCNY Math Review Chapters 5 and 6: Trigonometric functions and graphs
Ch 5. Trigonometry 6. Angles 6. Right triangles 6. Trig funs for general angles 5.: Trigonometric functions and graphs 5.5 Inverse functions CCNY Math Review Chapters 5 and 6: Trigonometric functions and
More informationWarm Up: please factor completely
Warm Up: please factor completely 1. 2. 3. 4. 5. 6. vocabulary KEY STANDARDS ADDRESSED: MA3A2. Students will use the circle to define the trigonometric functions. a. Define and understand angles measured
More informationChapter 4/5 Part 1- Trigonometry in Radians
Chapter 4/5 Part - Trigonometry in Radians Lesson Package MHF4U Chapter 4/5 Part Outline Unit Goal: By the end of this unit, you will be able to demonstrate an understanding of meaning and application
More information2.0 Trigonometry Review Date: Pythagorean Theorem: where c is always the.
2.0 Trigonometry Review Date: Key Ideas: The three angles in a triangle sum to. Pythagorean Theorem: where c is always the. In trigonometry problems, all vertices (corners or angles) of the triangle are
More informationVerifying Trigonometric Identities
40 Chapter Analytic Trigonometry. f x sec x Sketch the graph of y cos x Amplitude: Period: One cycle: first. The x-intercepts of y correspond to the vertical asymptotes of f x. cos x sec x 4 x, x 4 4,...
More informationSENIOR HIGH MATH LEAGUE April 24, GROUP IV Emphasis on TRIGONOMETRY
SENIOR HIGH MATH LEAGUE TEST A Write all radical expressions in simplified form and unless otherwise stated give exact answers. 1. Give the exact value for each of the following where the angle is given
More information3.0 Trigonometry Review
3.0 Trigonometry Review In trigonometry problems, all vertices (corners or angles) of the triangle are labeled with capital letters. The right angle is usually labeled C. Sides are usually labeled with
More information