Phylogenetic Trees - Parsimony Tutorial #11

Size: px
Start display at page:

Download "Phylogenetic Trees - Parsimony Tutorial #11"

Transcription

1 Phylogenetic rees Parsimony utorial #11 Ilan ronau.. Based on original slides of Ydo Wexler & Dan eiger Phylogenetic econstruction he input: a speciescharacters matrix he ouput: a tree with n leaves corresponding to the input species characters n species Each character represents some observable trait. Each character taes values from a finite set. 2 1

2 Most Parsimonious ree Parsimonyscore: Number of characterchanges (mutation along the evolutionary tree (tree containing labels on internal vertice Example: Score = 4 Score = 3 0 AAA 0 0 AAA 1 1 AAA 1 0 AAA 2 AA AA AAA A Most parsimonious tree: ree with minimal parsimony score 1 AAA 0 0 AA 1 AA AAA Minimal Evolution Principle AA A 3 Small vs. Large Parsimony We brea the problem into two: 1. Small parsimony: iven the topology find the best assignment to internal nodes 2. Large parsimony: Find the topology which gives best score Large parsimony is NPhard We ll show solution to small parsimony (Fitch and Sanoff s algorithm Input to small parsimony: tree with characterstate assignments to leaves Example: Aardvar Bison Chimp Dog Elephant A: CAA B: CAACA C: CA D: CAC E: CA 4 2

3 Fitch s Algorithm Execute independently for each character: 1. Bottomup phase: Determine set of possible states for each internal node 2. opdown phase: Pic states for each internal node Dynamic Programming framewor 1 2 Aardvar Bison Chimp Dog CAA CA CAACA CAC Elephant CA 5 Fitch s Algorithm Bottomup phase Determine set of possible states for each internal node Initialization: i = {s i } for all leaves Do a postorder (from leaves to root) traversal of tree Determine i of internal node i with children, : i C if C A A φ Parsimonyscore = # union operations score = 3 6 3

4 Fitch s Algorithm opdown phase Pic states for each internal node Pic arbitrary state in root for the root Do preorder (from root to leave traversal of tree Determine s of internal node with parent i: si if si s arbitrary state C C A A Complexity: O(mn) #states score = 3 #characters #taxa/nodes 7 Weighted Parsimony Sanoff s algorithm Each mutation a b costs differently S(a,b). 1. Bottomup phase: Determine i ( cost of optimal stateassignment for subtree of i, when it is assigned state s. 2. opdown phase: Pic optimal states for each internal node Same as algorithm for optimal lifted tree alignment (utorial #4) 8 4

5 Sanoff s Algorithm Bottomup phase Determine i ( for each internal node 0 if si = s Initialization: i ( Do a postorder (from leaves to root) traversal of tree Determine i of internal node i with children, : { ( s') + S( } + min { ( s') S( } ( = min s' s' i + Natural generalization For nonbinary trees C A emember pointers s s 9 Sanoff s Algorithm opdown phase Pic states for each internal node Select minimal cost character for root (s minimizing root () Do preorder (from root to leave traversal of tree: For internal node, with parent i, select state that produced minimal cost at i (use pointers ept in 1 st stage) min i ( = min s { ( s') + S( } ' { ( s') + S( } + s' Complexity: O(m 2 n) C A #states #characters #taxa/nodes 10 5

6 Fitch s Algorithm as special case of Sanoff s algorithm Unweighted parsimony: 0 if a = b S ( a, b) 1 Sanoff s algorithm: i ( cost of optimal subtree of i, when it is assigned state s Fitch s algorithm: Score(i) cost of optimal stateassignment for subtree of i i set of optimal stateassignment for subtree of i We need to show that: tricy part 1. here is an optimal tree which assigns node i with state from i. 2. Fitch s bottomup recursive formula for i. is correct: i if φ Chec for yourselves 11 Fitch s Algorithm as special case of Sanoff s algorithm 0 if a = b Unweighted parsimony: S ( a, b) 1 Score(i) cost of optimal stateassignment for subtree of i i set of optimal stateassignment for subtree of i We need to show that: 1. here is an optimal tree which assigns node i with state from i. rivially true for the root Assume (to the contrary) that in an optimal assignment, some node is assigned s Why is this not the case for the weighted version? i root Parsimonyscore is integer s (s ) Score()+1 By switching from s to some s we do not raise the parsimonyscore 12 6

7 Exploring the Space of rees We saw how to find optimal stateassignment for a given tree topology We need to explore space of topologies iven n sequences there are (2n3)!! possible rooted trees and (2n5)!! possible unrooted trees 2 n!! = n 2 n ( n 2)! taxa (n) # rooted trees # unrooted trees ,135 10, ,459,425 2,027, Exploring the Space of rees Possible solutions: 1. Heuristic solutions for traveling through topologyspace 2. Find (basic) topology using distancebased methods (NJ) Notice another problem: We obtain stateassignments to taxa using multiple alignment We obtain optimal MA using topology of phylogenetic tree (e.g. CLUSAL) Solution: Again, use some initial topology (via NJ) A A A C C C C 1,C 2,, C m 14 7

Parsimony-Based Approaches to Inferring Phylogenetic Trees

Parsimony-Based Approaches to Inferring Phylogenetic Trees Parsimony-Based Approaches to Inferring Phylogenetic Trees BMI/CS 576 www.biostat.wisc.edu/bmi576.html Mark Craven craven@biostat.wisc.edu Fall 0 Phylogenetic tree approaches! three general types! distance:

More information

Multiple Sequence Alignment

Multiple Sequence Alignment . Multiple Sequence lignment utorial #4 Ilan ronau Multiple Sequence lignment Reminder S = S = S = Possible alignment Possible alignment Multiple Sequence lignment Reminder Input: Sequences S, S,, S over

More information

CISC 636 Computational Biology & Bioinformatics (Fall 2016) Phylogenetic Trees (I)

CISC 636 Computational Biology & Bioinformatics (Fall 2016) Phylogenetic Trees (I) CISC 636 Computational iology & ioinformatics (Fall 2016) Phylogenetic Trees (I) Maximum Parsimony CISC636, F16, Lec13, Liao 1 Evolution Mutation, selection, Only the Fittest Survive. Speciation. t one

More information

Molecular Evolution & Phylogenetics Complexity of the search space, distance matrix methods, maximum parsimony

Molecular Evolution & Phylogenetics Complexity of the search space, distance matrix methods, maximum parsimony Molecular Evolution & Phylogenetics Complexity of the search space, distance matrix methods, maximum parsimony Basic Bioinformatics Workshop, ILRI Addis Ababa, 12 December 2017 Learning Objectives understand

More information

human chimp mouse rat

human chimp mouse rat Michael rudno These notes are based on earlier notes by Tomas abak Phylogenetic Trees Phylogenetic Trees demonstrate the amoun of evolution, and order of divergence for several genomes. Phylogenetic trees

More information

Assignment 3 Phylogenetic Tree Reconstruction and Motif Finding

Assignment 3 Phylogenetic Tree Reconstruction and Motif Finding ssignment Phylogenetic ree Reconstruction and Motif Finding Lecturer: Michal Ziv-Ukelson ssignment hecker: Dina Svetlitsky You may submit the assignment in pairs. Explain your answers as clearly as possible

More information

Phylogenetics on CUDA (Parallel) Architectures Bradly Alicea

Phylogenetics on CUDA (Parallel) Architectures Bradly Alicea Descent w/modification Descent w/modification Descent w/modification Descent w/modification CPU Descent w/modification Descent w/modification Phylogenetics on CUDA (Parallel) Architectures Bradly Alicea

More information

CSE 549: Computational Biology

CSE 549: Computational Biology CSE 549: Computational Biology Phylogenomics 1 slides marked with * by Carl Kingsford Tree of Life 2 * H5N1 Influenza Strains Salzberg, Kingsford, et al., 2007 3 * H5N1 Influenza Strains The 2007 outbreak

More information

Chapter 20: Binary Trees

Chapter 20: Binary Trees Chapter 20: Binary Trees 20.1 Definition and Application of Binary Trees Definition and Application of Binary Trees Binary tree: a nonlinear linked list in which each node may point to 0, 1, or two other

More information

The worst case complexity of Maximum Parsimony

The worst case complexity of Maximum Parsimony he worst case complexity of Maximum Parsimony mir armel Noa Musa-Lempel Dekel sur Michal Ziv-Ukelson Ben-urion University June 2, 20 / 2 What s a phylogeny Phylogenies: raph-like structures whose topology

More information

BMI/CS 576 Fall 2015 Midterm Exam

BMI/CS 576 Fall 2015 Midterm Exam BMI/CS 576 Fall 2015 Midterm Exam Prof. Colin Dewey Tuesday, October 27th, 2015 11:00am-12:15pm Name: KEY Write your answers on these pages and show your work. You may use the back sides of pages as necessary.

More information

Genetics/MBT 541 Spring, 2002 Lecture 1 Joe Felsenstein Department of Genome Sciences Phylogeny methods, part 1 (Parsimony and such)

Genetics/MBT 541 Spring, 2002 Lecture 1 Joe Felsenstein Department of Genome Sciences Phylogeny methods, part 1 (Parsimony and such) Genetics/MBT 541 Spring, 2002 Lecture 1 Joe Felsenstein Department of Genome Sciences joe@gs Phylogeny methods, part 1 (Parsimony and such) Methods of reconstructing phylogenies (evolutionary trees) Parsimony

More information

Terminology. A phylogeny is the evolutionary history of an organism

Terminology. A phylogeny is the evolutionary history of an organism Phylogeny Terminology A phylogeny is the evolutionary history of an organism A taxon (plural: taxa) is a group of (one or more) organisms, which a taxonomist adjudges to be a unit. A definition? from Wikipedia

More information

What is a phylogenetic tree? Algorithms for Computational Biology. Phylogenetics Summary. Di erent types of phylogenetic trees

What is a phylogenetic tree? Algorithms for Computational Biology. Phylogenetics Summary. Di erent types of phylogenetic trees What is a phylogenetic tree? Algorithms for Computational Biology Zsuzsanna Lipták speciation events Masters in Molecular and Medical Biotechnology a.a. 25/6, fall term Phylogenetics Summary wolf cat lion

More information

Section 5.5. Left subtree The left subtree of a vertex V on a binary tree is the graph formed by the left child L of V, the descendents

Section 5.5. Left subtree The left subtree of a vertex V on a binary tree is the graph formed by the left child L of V, the descendents Section 5.5 Binary Tree A binary tree is a rooted tree in which each vertex has at most two children and each child is designated as being a left child or a right child. Thus, in a binary tree, each vertex

More information

Evolutionary tree reconstruction (Chapter 10)

Evolutionary tree reconstruction (Chapter 10) Evolutionary tree reconstruction (Chapter 10) Early Evolutionary Studies Anatomical features were the dominant criteria used to derive evolutionary relationships between species since Darwin till early

More information

EVOLUTIONARY DISTANCES INFERRING PHYLOGENIES

EVOLUTIONARY DISTANCES INFERRING PHYLOGENIES EVOLUTIONARY DISTANCES INFERRING PHYLOGENIES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 28 th November 2007 OUTLINE 1 INFERRING

More information

Course Review for Finals. Cpt S 223 Fall 2008

Course Review for Finals. Cpt S 223 Fall 2008 Course Review for Finals Cpt S 223 Fall 2008 1 Course Overview Introduction to advanced data structures Algorithmic asymptotic analysis Programming data structures Program design based on performance i.e.,

More information

Binary Trees, Binary Search Trees

Binary Trees, Binary Search Trees Binary Trees, Binary Search Trees Trees Linear access time of linked lists is prohibitive Does there exist any simple data structure for which the running time of most operations (search, insert, delete)

More information

Phylogenetics. Introduction to Bioinformatics Dortmund, Lectures: Sven Rahmann. Exercises: Udo Feldkamp, Michael Wurst

Phylogenetics. Introduction to Bioinformatics Dortmund, Lectures: Sven Rahmann. Exercises: Udo Feldkamp, Michael Wurst Phylogenetics Introduction to Bioinformatics Dortmund, 16.-20.07.2007 Lectures: Sven Rahmann Exercises: Udo Feldkamp, Michael Wurst 1 Phylogenetics phylum = tree phylogenetics: reconstruction of evolutionary

More information

Parsimony methods. Chapter 1

Parsimony methods. Chapter 1 Chapter 1 Parsimony methods Parsimony methods are the easiest ones to explain, and were also among the first methods for inferring phylogenies. The issues that they raise also involve many of the phenomena

More information

Codon models. In reality we use codon model Amino acid substitution rates meet nucleotide models Codon(nucleotide triplet)

Codon models. In reality we use codon model Amino acid substitution rates meet nucleotide models Codon(nucleotide triplet) Phylogeny Codon models Last lecture: poor man s way of calculating dn/ds (Ka/Ks) Tabulate synonymous/non- synonymous substitutions Normalize by the possibilities Transform to genetic distance K JC or K

More information

Trees. Q: Why study trees? A: Many advance ADTs are implemented using tree-based data structures.

Trees. Q: Why study trees? A: Many advance ADTs are implemented using tree-based data structures. Trees Q: Why study trees? : Many advance DTs are implemented using tree-based data structures. Recursive Definition of (Rooted) Tree: Let T be a set with n 0 elements. (i) If n = 0, T is an empty tree,

More information

Binary Trees

Binary Trees Binary Trees 4-7-2005 Opening Discussion What did we talk about last class? Do you have any code to show? Do you have any questions about the assignment? What is a Tree? You are all familiar with what

More information

12/5/17. trees. CS 220: Discrete Structures and their Applications. Trees Chapter 11 in zybooks. rooted trees. rooted trees

12/5/17. trees. CS 220: Discrete Structures and their Applications. Trees Chapter 11 in zybooks. rooted trees. rooted trees trees CS 220: Discrete Structures and their Applications A tree is an undirected graph that is connected and has no cycles. Trees Chapter 11 in zybooks rooted trees Rooted trees. Given a tree T, choose

More information

Generation of distancebased phylogenetic trees

Generation of distancebased phylogenetic trees primer for practical phylogenetic data gathering. Uconn EEB3899-007. Spring 2015 Session 12 Generation of distancebased phylogenetic trees Rafael Medina (rafael.medina.bry@gmail.com) Yang Liu (yang.liu@uconn.edu)

More information

Friday, March 30. Last time we were talking about traversal of a rooted ordered tree, having defined preorder traversal. We will continue from there.

Friday, March 30. Last time we were talking about traversal of a rooted ordered tree, having defined preorder traversal. We will continue from there. Friday, March 30 Last time we were talking about traversal of a rooted ordered tree, having defined preorder traversal. We will continue from there. Postorder traversal (recursive definition) If T consists

More information

CS 581. Tandy Warnow

CS 581. Tandy Warnow CS 581 Tandy Warnow This week Maximum parsimony: solving it on small datasets Maximum Likelihood optimization problem Felsenstein s pruning algorithm Bayesian MCMC methods Research opportunities Maximum

More information

Trees. CSE 373 Data Structures

Trees. CSE 373 Data Structures Trees CSE 373 Data Structures Readings Reading Chapter 7 Trees 2 Why Do We Need Trees? Lists, Stacks, and Queues are linear relationships Information often contains hierarchical relationships File directories

More information

Phylogenetic Trees Lecture 12. Section 7.4, in Durbin et al., 6.5 in Setubal et al. Shlomo Moran, Ilan Gronau

Phylogenetic Trees Lecture 12. Section 7.4, in Durbin et al., 6.5 in Setubal et al. Shlomo Moran, Ilan Gronau Phylogenetic Trees Lecture 12 Section 7.4, in Durbin et al., 6.5 in Setubal et al. Shlomo Moran, Ilan Gronau. Maximum Parsimony. Last week we presented Fitch algorithm for (unweighted) Maximum Parsimony:

More information

TREES. Trees - Introduction

TREES. Trees - Introduction TREES Chapter 6 Trees - Introduction All previous data organizations we've studied are linear each element can have only one predecessor and successor Accessing all elements in a linear sequence is O(n)

More information

INF2220: algorithms and data structures Series 1

INF2220: algorithms and data structures Series 1 Universitetet i Oslo Institutt for Informatikk A. Maus, R.K. Runde, I. Yu INF2220: algorithms and data structures Series 1 Topic Trees & estimation of running time (Exercises with hints for solution) Issued:

More information

Dynamic Programming: Widget Layout

Dynamic Programming: Widget Layout Dynamic Programming: Widget Layout Setup There are two types of widgets. A leaf widget is a visible widget that someone may see or use, such as a button or an image. Every leaf widget has a list of possible

More information

Recent Research Results. Evolutionary Trees Distance Methods

Recent Research Results. Evolutionary Trees Distance Methods Recent Research Results Evolutionary Trees Distance Methods Indo-European Languages After Tandy Warnow What is the purpose? Understand evolutionary history (relationship between species). Uderstand how

More information

Course Review. Cpt S 223 Fall 2009

Course Review. Cpt S 223 Fall 2009 Course Review Cpt S 223 Fall 2009 1 Final Exam When: Tuesday (12/15) 8-10am Where: in class Closed book, closed notes Comprehensive Material for preparation: Lecture slides & class notes Homeworks & program

More information

Abstract Data Structures IB Computer Science. Content developed by Dartford Grammar School Computer Science Department

Abstract Data Structures IB Computer Science. Content developed by Dartford Grammar School Computer Science Department Abstract Data Structures IB Computer Science Content developed by Dartford Grammar School Computer Science Department HL Topics 1-7, D1-4 1: System design 2: Computer Organisation 3: Networks 4: Computational

More information

Data Structure Lecture#10: Binary Trees (Chapter 5) U Kang Seoul National University

Data Structure Lecture#10: Binary Trees (Chapter 5) U Kang Seoul National University Data Structure Lecture#10: Binary Trees (Chapter 5) U Kang Seoul National University U Kang (2016) 1 In This Lecture The concept of binary tree, its terms, and its operations Full binary tree theorem Idea

More information

March 20/2003 Jayakanth Srinivasan,

March 20/2003 Jayakanth Srinivasan, Definition : A simple graph G = (V, E) consists of V, a nonempty set of vertices, and E, a set of unordered pairs of distinct elements of V called edges. Definition : In a multigraph G = (V, E) two or

More information

CSCI-401 Examlet #5. Name: Class: Date: True/False Indicate whether the sentence or statement is true or false.

CSCI-401 Examlet #5. Name: Class: Date: True/False Indicate whether the sentence or statement is true or false. Name: Class: Date: CSCI-401 Examlet #5 True/False Indicate whether the sentence or statement is true or false. 1. The root node of the standard binary tree can be drawn anywhere in the tree diagram. 2.

More information

Parsimony Least squares Minimum evolution Balanced minimum evolution Maximum likelihood (later in the course)

Parsimony Least squares Minimum evolution Balanced minimum evolution Maximum likelihood (later in the course) Tree Searching We ve discussed how we rank trees Parsimony Least squares Minimum evolution alanced minimum evolution Maximum likelihood (later in the course) So we have ways of deciding what a good tree

More information

46 Grundlagen der Bioinformatik, SoSe 11, D. Huson, May 16, 2011

46 Grundlagen der Bioinformatik, SoSe 11, D. Huson, May 16, 2011 46 Grundlagen der Bioinformatik, SoSe 11, D. Huson, May 16, 011 Phylogeny Further reading and sources for parts of this hapter: R. Durbin, S. Eddy,. Krogh & G. Mitchison, Biological sequence analysis,

More information

Dynamic Programming for Phylogenetic Estimation

Dynamic Programming for Phylogenetic Estimation 1 / 45 Dynamic Programming for Phylogenetic Estimation CS598AGB Pranjal Vachaspati University of Illinois at Urbana-Champaign 2 / 45 Coalescent-based Species Tree Estimation Find evolutionary tree for

More information

ADTS, GRAMMARS, PARSING, TREE TRAVERSALS

ADTS, GRAMMARS, PARSING, TREE TRAVERSALS 1 Pointers to material ADS, GRAMMARS, PARSING, R RAVRSALS Lecture 13 CS110 all 016 Parse trees: text, section 3.36 Definition of Java Language, sometimes useful: docs.oracle.com/javase/specs/jls/se8/html/index.html

More information

Trees : Part 1. Section 4.1. Theory and Terminology. A Tree? A Tree? Theory and Terminology. Theory and Terminology

Trees : Part 1. Section 4.1. Theory and Terminology. A Tree? A Tree? Theory and Terminology. Theory and Terminology Trees : Part Section. () (2) Preorder, Postorder and Levelorder Traversals Definition: A tree is a connected graph with no cycles Consequences: Between any two vertices, there is exactly one unique path

More information

ADTS, GRAMMARS, PARSING, TREE TRAVERSALS. Regrades 10/6/15. Prelim 1. Prelim 1. Expression trees. Pointers to material

ADTS, GRAMMARS, PARSING, TREE TRAVERSALS. Regrades 10/6/15. Prelim 1. Prelim 1. Expression trees. Pointers to material 1 Prelim 1 2 Max: 99 Mean: 71.2 Median: 73 Std Dev: 1.6 ADS, GRAMMARS, PARSING, R RAVRSALS Lecture 12 CS2110 Spring 2015 3 Prelim 1 Score Grade % 90-99 A 82-89 A-/A 26% 70-82 B/B 62-69 B-/B 50% 50-59 C-/C

More information

Binary Search Trees. See Section 11.1 of the text.

Binary Search Trees. See Section 11.1 of the text. Binary Search Trees See Section 11.1 of the text. Consider the following Binary Search Tree 17 This tree has a nice property: for every node, all of the nodes in its left subtree have values less than

More information

Cpt S 122 Data Structures. Data Structures Trees

Cpt S 122 Data Structures. Data Structures Trees Cpt S 122 Data Structures Data Structures Trees Nirmalya Roy School of Electrical Engineering and Computer Science Washington State University Motivation Trees are one of the most important and extensively

More information

Lecture: Bioinformatics

Lecture: Bioinformatics Lecture: Bioinformatics ENS Sacley, 2018 Some slides graciously provided by Daniel Huson & Celine Scornavacca Phylogenetic Trees - Motivation 2 / 31 2 / 31 Phylogenetic Trees - Motivation Motivation -

More information

Phylogeny and Molecular Evolution

Phylogeny and Molecular Evolution Phylogeny nd Moleculr Evolution Chrcter Bsed Phylogeny 1/50 Credit Ron Shmir s lecture notes Notes by Nir Friedmn Dn Geiger, Shlomo Morn, Sgi Snir nd Ron Shmir Durbin et l. Jones nd Pevzner s presenttion

More information

Evolutionary Trees. Fredrik Ronquist. August 29, 2005

Evolutionary Trees. Fredrik Ronquist. August 29, 2005 Evolutionary Trees Fredrik Ronquist August 29, 2005 1 Evolutionary Trees Tree is an important concept in Graph Theory, Computer Science, Evolutionary Biology, and many other areas. In evolutionary biology,

More information

Friday Four Square! 4:15PM, Outside Gates

Friday Four Square! 4:15PM, Outside Gates Binary Search Trees Friday Four Square! 4:15PM, Outside Gates Implementing Set On Monday and Wednesday, we saw how to implement the Map and Lexicon, respectively. Let's now turn our attention to the Set.

More information

INF2220: algorithms and data structures Series 1

INF2220: algorithms and data structures Series 1 Universitetet i Oslo Institutt for Informatikk I. Yu, D. Karabeg INF2220: algorithms and data structures Series 1 Topic Function growth & estimation of running time, trees Issued: 24. 08. 2016 Exercise

More information

Lecture 3: Graphs and flows

Lecture 3: Graphs and flows Chapter 3 Lecture 3: Graphs and flows Graphs: a useful combinatorial structure. Definitions: graph, directed and undirected graph, edge as ordered pair, path, cycle, connected graph, strongly connected

More information

Data Structure Lecture#14: Non-Binary Trees (Chapter 6) U Kang Seoul National University

Data Structure Lecture#14: Non-Binary Trees (Chapter 6) U Kang Seoul National University Data Structure Lecture#14: Non-Binary Trees (Chapter 6) U Kang Seoul National University U Kang 1 In This Lecture The concept of the general tree, its ADT, and its operation Motivation and the main idea

More information

Construction of a distance tree using clustering with the Unweighted Pair Group Method with Arithmatic Mean (UPGMA).

Construction of a distance tree using clustering with the Unweighted Pair Group Method with Arithmatic Mean (UPGMA). Construction of a distance tree using clustering with the Unweighted Pair Group Method with Arithmatic Mean (UPGMA). The UPGMA is the simplest method of tree construction. It was originally developed for

More information

Olivier Gascuel Arbres formels et Arbre de la Vie Conférence ENS Cachan, septembre Arbres formels et Arbre de la Vie.

Olivier Gascuel Arbres formels et Arbre de la Vie Conférence ENS Cachan, septembre Arbres formels et Arbre de la Vie. Arbres formels et Arbre de la Vie Olivier Gascuel Centre National de la Recherche Scientifique LIRMM, Montpellier, France www.lirmm.fr/gascuel 10 permanent researchers 2 technical staff 3 postdocs, 10

More information

ADTS, GRAMMARS, PARSING, TREE TRAVERSALS

ADTS, GRAMMARS, PARSING, TREE TRAVERSALS 1 Prelim 1 2 Where: Kennedy Auditorium When: A-Lib: 5:30-7 Lie-Z: 7:30-9 (unless we explicitly notified you otherwise) ADS, GRAMMARS, PARSING, R RAVRSALS Lecture 13 CS2110 Spring 2016 Pointers to material

More information

CS350: Data Structures Tree Traversal

CS350: Data Structures Tree Traversal Tree Traversal James Moscola Department of Engineering & Computer Science York College of Pennsylvania James Moscola Defining Trees Recursively Trees can easily be defined recursively Definition of a binary

More information

Garbage Collection: recycling unused memory

Garbage Collection: recycling unused memory Outline backtracking garbage collection trees binary search trees tree traversal binary search tree algorithms: add, remove, traverse binary node class 1 Backtracking finding a path through a maze is an

More information

Trees. Tree Structure Binary Tree Tree Traversals

Trees. Tree Structure Binary Tree Tree Traversals Trees Tree Structure Binary Tree Tree Traversals The Tree Structure Consists of nodes and edges that organize data in a hierarchical fashion. nodes store the data elements. edges connect the nodes. The

More information

CH 8. HEAPS AND PRIORITY QUEUES

CH 8. HEAPS AND PRIORITY QUEUES CH 8. HEAPS AND PRIORITY QUEUES ACKNOWLEDGEMENT: THESE SLIDES ARE ADAPTED FROM SLIDES PROVIDED WITH DATA STRUCTURES AND ALGORITHMS IN C++, GOODRICH, TAMASSIA AND MOUNT (WILEY 2004) AND SLIDES FROM NANCY

More information

UNIT IV -NON-LINEAR DATA STRUCTURES 4.1 Trees TREE: A tree is a finite set of one or more nodes such that there is a specially designated node called the Root, and zero or more non empty sub trees T1,

More information

CH. 8 PRIORITY QUEUES AND HEAPS

CH. 8 PRIORITY QUEUES AND HEAPS CH. 8 PRIORITY QUEUES AND HEAPS ACKNOWLEDGEMENT: THESE SLIDES ARE ADAPTED FROM SLIDES PROVIDED WITH DATA STRUCTURES AND ALGORITHMS IN C++, GOODRICH, TAMASSIA AND MOUNT (WILEY 2004) AND SLIDES FROM NANCY

More information

Binary Trees. Examples:

Binary Trees. Examples: Binary Trees A tree is a data structure that is made of nodes and pointers, much like a linked list. The difference between them lies in how they are organized: In a linked list each node is connected

More information

ADTS, GRAMMARS, PARSING, TREE TRAVERSALS

ADTS, GRAMMARS, PARSING, TREE TRAVERSALS 3//15 1 AD: Abstract Data ype 2 Just like a type: Bunch of values together with operations on them. Used often in discussing data structures Important: he definition says ntthing about the implementation,

More information

Trees. Example: Binary expression trees. Example: Evolution trees. Readings: HtDP, sections 14, 15, 16.

Trees. Example: Binary expression trees. Example: Evolution trees. Readings: HtDP, sections 14, 15, 16. Trees Readings: HtDP, sections 14, 15, 16. We will cover the ideas in the text using different examples and different terminology. The readings are still important as an additional source of examples.

More information

Trees. (Trees) Data Structures and Programming Spring / 28

Trees. (Trees) Data Structures and Programming Spring / 28 Trees (Trees) Data Structures and Programming Spring 2018 1 / 28 Trees A tree is a collection of nodes, which can be empty (recursive definition) If not empty, a tree consists of a distinguished node r

More information

Graphs V={A,B,C,D,E} E={ (A,D),(A,E),(B,D), (B,E),(C,D),(C,E)}

Graphs V={A,B,C,D,E} E={ (A,D),(A,E),(B,D), (B,E),(C,D),(C,E)} Graphs and Trees 1 Graphs (simple) graph G = (V, ) consists of V, a nonempty set of vertices and, a set of unordered pairs of distinct vertices called edges. xamples V={,,,,} ={ (,),(,),(,), (,),(,),(,)}

More information

Distance based tree reconstruction. Hierarchical clustering (UPGMA) Neighbor-Joining (NJ)

Distance based tree reconstruction. Hierarchical clustering (UPGMA) Neighbor-Joining (NJ) Distance based tree reconstruction Hierarchical clustering (UPGMA) Neighbor-Joining (NJ) All organisms have evolved from a common ancestor. Infer the evolutionary tree (tree topology and edge lengths)

More information

Name CPTR246 Spring '17 (100 total points) Exam 3

Name CPTR246 Spring '17 (100 total points) Exam 3 Name CPTR246 Spring '17 (100 total points) Exam 3 1. Linked Lists Consider the following linked list of integers (sorted from lowest to highest) and the changes described. Make the necessary changes in

More information

Bioinformatics. Gabriella Trucco.

Bioinformatics. Gabriella Trucco. Bioinformatics Gabriella Trucco Email: gabriella.trucco@unimi.it Organization Course times: Tuesday 9:30-13:00 Language: English Webpage: http://homes.di.unimi.it/trucco/bioinformatics will include: current

More information

7.1 Introduction. A (free) tree T is A simple graph such that for every pair of vertices v and w there is a unique path from v to w

7.1 Introduction. A (free) tree T is A simple graph such that for every pair of vertices v and w there is a unique path from v to w Chapter 7 Trees 7.1 Introduction A (free) tree T is A simple graph such that for every pair of vertices v and w there is a unique path from v to w Tree Terminology Parent Ancestor Child Descendant Siblings

More information

Multiple Sequence Alignment. Mark Whitsitt - NCSA

Multiple Sequence Alignment. Mark Whitsitt - NCSA Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV

More information

ABOUT THE LARGEST SUBTREE COMMON TO SEVERAL PHYLOGENETIC TREES Alain Guénoche 1, Henri Garreta 2 and Laurent Tichit 3

ABOUT THE LARGEST SUBTREE COMMON TO SEVERAL PHYLOGENETIC TREES Alain Guénoche 1, Henri Garreta 2 and Laurent Tichit 3 The XIII International Conference Applied Stochastic Models and Data Analysis (ASMDA-2009) June 30-July 3, 2009, Vilnius, LITHUANIA ISBN 978-9955-28-463-5 L. Sakalauskas, C. Skiadas and E. K. Zavadskas

More information

Trees. Truong Tuan Anh CSE-HCMUT

Trees. Truong Tuan Anh CSE-HCMUT Trees Truong Tuan Anh CSE-HCMUT Outline Basic concepts Trees Trees A tree consists of a finite set of elements, called nodes, and a finite set of directed lines, called branches, that connect the nodes

More information

CE 221 Data Structures and Algorithms

CE 221 Data Structures and Algorithms CE 221 Data Structures and Algorithms Chapter 4: Trees (Binary) Text: Read Weiss, 4.1 4.2 Izmir University of Economics 1 Preliminaries - I (Recursive) Definition: A tree is a collection of nodes. The

More information

Stores a collection of elements each with an associated key value

Stores a collection of elements each with an associated key value CH9. PRIORITY QUEUES ACKNOWLEDGEMENT: THESE SLIDES ARE ADAPTED FROM SLIDES PROVIDED WITH DATA STRUCTURES AND ALGORITHMS IN JAVA, GOODRICH, TAMASSIA AND GOLDWASSER (WILEY 201) PRIORITY QUEUES Stores a collection

More information

Chapter 5. Binary Trees

Chapter 5. Binary Trees Chapter 5 Binary Trees Definitions and Properties A binary tree is made up of a finite set of elements called nodes It consists of a root and two subtrees There is an edge from the root to its children

More information

Binary Heaps in Dynamic Arrays

Binary Heaps in Dynamic Arrays Yufei Tao ITEE University of Queensland We have already learned that the binary heap serves as an efficient implementation of a priority queue. Our previous discussion was based on pointers (for getting

More information

CSC148-Section:L0301

CSC148-Section:L0301 Slides adapted from Professor Danny Heap course material winter17 CSC148-Section:L0301 Week#8-Friday Instructed by AbdulAziz Al-Helali a.alhelali@mail.utoronto.ca Office hours: Wednesday 11-1, BA2230.

More information

Tree. A path is a connected sequence of edges. A tree topology is acyclic there is no loop.

Tree. A path is a connected sequence of edges. A tree topology is acyclic there is no loop. Tree A tree consists of a set of nodes and a set of edges connecting pairs of nodes. A tree has the property that there is exactly one path (no more, no less) between any pair of nodes. A path is a connected

More information

1. Stack overflow & underflow 2. Implementation: partially filled array & linked list 3. Applications: reverse string, backtracking

1. Stack overflow & underflow 2. Implementation: partially filled array & linked list 3. Applications: reverse string, backtracking Review for Test 2 (Chapter 6-10) Chapter 6: Template functions & classes 1) What is the primary purpose of template functions? A. To allow a single function to be used with varying types of arguments B.

More information

Bioinformatics Programming. EE, NCKU Tien-Hao Chang (Darby Chang)

Bioinformatics Programming. EE, NCKU Tien-Hao Chang (Darby Chang) Bioinformatics Programming EE, NCKU Tien-Hao Chang (Darby Chang) 1 Tree 2 A Tree Structure A tree structure means that the data are organized so that items of information are related by branches 3 Definition

More information

Why Do We Need Trees?

Why Do We Need Trees? CSE 373 Lecture 6: Trees Today s agenda: Trees: Definition and terminology Traversing trees Binary search trees Inserting into and deleting from trees Covered in Chapter 4 of the text Why Do We Need Trees?

More information

Isometric gene tree reconciliation revisited

Isometric gene tree reconciliation revisited DOI 0.86/s05-07-008-x Algorithms for Molecular Biology RESEARCH Open Access Isometric gene tree reconciliation revisited Broňa Brejová *, Askar Gafurov, Dana Pardubská, Michal Sabo and Tomáš Vinař Abstract

More information

syntax tree - * * * - * * * * * 2 1 * * 2 * (2 * 1) - (1 + 0)

syntax tree - * * * - * * * * * 2 1 * * 2 * (2 * 1) - (1 + 0) 0//7 xpression rees rom last time: we can draw a syntax tree for the Java expression ( 0). 0 ASS, GRAMMARS, PARSING, R RAVRSALS Lecture 3 CS0 all 07 Preorder, Postorder, and Inorder Preorder, Postorder,

More information

Algorithms in Systems Engineering ISE 172. Lecture 16. Dr. Ted Ralphs

Algorithms in Systems Engineering ISE 172. Lecture 16. Dr. Ted Ralphs Algorithms in Systems Engineering ISE 172 Lecture 16 Dr. Ted Ralphs ISE 172 Lecture 16 1 References for Today s Lecture Required reading Sections 6.5-6.7 References CLRS Chapter 22 R. Sedgewick, Algorithms

More information

1) What is the primary purpose of template functions? 2) Suppose bag is a template class, what is the syntax for declaring a bag b of integers?

1) What is the primary purpose of template functions? 2) Suppose bag is a template class, what is the syntax for declaring a bag b of integers? Review for Final (Chapter 6 13, 15) 6. Template functions & classes 1) What is the primary purpose of template functions? A. To allow a single function to be used with varying types of arguments B. To

More information

Main Reference. Marc A. Suchard: Stochastic Models for Horizontal Gene Transfer: Taking a Random Walk through Tree Space Genetics 2005

Main Reference. Marc A. Suchard: Stochastic Models for Horizontal Gene Transfer: Taking a Random Walk through Tree Space Genetics 2005 Stochastic Models for Horizontal Gene Transfer Dajiang Liu Department of Statistics Main Reference Marc A. Suchard: Stochastic Models for Horizontal Gene Transfer: Taing a Random Wal through Tree Space

More information

Trees. Introduction & Terminology. February 05, 2018 Cinda Heeren / Geoffrey Tien 1

Trees. Introduction & Terminology. February 05, 2018 Cinda Heeren / Geoffrey Tien 1 Trees Introduction & Terminology Cinda Heeren / Geoffrey Tien 1 Review: linked lists Linked lists are constructed out of nodes, consisting of a data element a pointer to another node Lists are constructed

More information

CMPSCI 187: Programming With Data Structures. Lecture #26: Binary Search Trees David Mix Barrington 9 November 2012

CMPSCI 187: Programming With Data Structures. Lecture #26: Binary Search Trees David Mix Barrington 9 November 2012 CMPSCI 187: Programming With Data Structures Lecture #26: Binary Search Trees David Mix Barrington 9 November 2012 Binary Search Trees Why Binary Search Trees? Trees, Binary Trees and Vocabulary The BST

More information

Programming II (CS300)

Programming II (CS300) 1 Programming II (CS300) Chapter 11: Binary Search Trees MOUNA KACEM mouna@cs.wisc.edu Fall 2018 General Overview of Data Structures 2 Introduction to trees 3 Tree: Important non-linear data structure

More information

Index-assisted approximate matching

Index-assisted approximate matching Index-assisted approximate matching Ben Langmead Department of Computer Science You are free to use these slides. If you do, please sign the guestbook (www.langmead-lab.org/teaching-materials), or email

More information

CSI33 Data Structures

CSI33 Data Structures Outline Department of Mathematics and Computer Science Bronx Community College November 13, 2017 Outline Outline 1 C++ Supplement.1: Trees Outline C++ Supplement.1: Trees 1 C++ Supplement.1: Trees Uses

More information

DIMACS Tutorial on Phylogenetic Trees and Rapidly Evolving Pathogens. Katherine St. John City University of New York 1

DIMACS Tutorial on Phylogenetic Trees and Rapidly Evolving Pathogens. Katherine St. John City University of New York 1 DIMACS Tutorial on Phylogenetic Trees and Rapidly Evolving Pathogens Katherine St. John City University of New York 1 Thanks to the DIMACS Staff Linda Casals Walter Morris Nicole Clark Katherine St. John

More information

Lecture 6: Analysis of Algorithms (CS )

Lecture 6: Analysis of Algorithms (CS ) Lecture 6: Analysis of Algorithms (CS583-002) Amarda Shehu October 08, 2014 1 Outline of Today s Class 2 Traversals Querying Insertion and Deletion Sorting with BSTs 3 Red-black Trees Height of a Red-black

More information

Binary Search Trees. What is a Binary Search Tree?

Binary Search Trees. What is a Binary Search Tree? Binary Search Trees What is a Binary Search Tree? A binary tree where each node is an object Each node has a key value, left child, and right child (might be empty) Each node satisfies the binary search

More information

Lecture 26. Introduction to Trees. Trees

Lecture 26. Introduction to Trees. Trees Lecture 26 Introduction to Trees Trees Trees are the name given to a versatile group of data structures. They can be used to implement a number of abstract interfaces including the List, but those applications

More information

Course Review for. Cpt S 223 Fall Cpt S 223. School of EECS, WSU

Course Review for. Cpt S 223 Fall Cpt S 223. School of EECS, WSU Course Review for Midterm Exam 1 Cpt S 223 Fall 2011 1 Midterm Exam 1 When: Friday (10/14) 1:10-2pm Where: in class Closed book, closed notes Comprehensive Material for preparation: Lecture slides & in-class

More information

Priority Queues Heaps Heapsort

Priority Queues Heaps Heapsort Priority Queues Heaps Heapsort After this lesson, you should be able to apply the binary heap insertion and deletion algorithms by hand implement the binary heap insertion and deletion algorithms explain

More information