FASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm.
|
|
- Georgina Fitzgerald
- 6 years ago
- Views:
Transcription
1 FASTA INTRODUCTION Definition (by David J. Lipman and William R. Pearson in 1985) - Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Key Notes: Sequence Alignment - is a way of arranging the sequences of DNA, RNA, or protein to identify regions of similarity that may be a consequence of functional, structural, or evolutionary relationships between the sequences. Sequence Similarity Searching - a method of searching sequence databases by using alignment to a query sequence. By statistically assessing how well database and query sequences match one can infer homology and transfer information to the query sequence. The current FASTA package contains programs for : Protein<>protein searches DNA<>DNA searches protein:translated DNA (with frameshifts) ordered or unordered peptide searches. The FASTA programs find regions of local or global (new) similarity between Protein or DNA sequences, either by searching Protein or DNA databases, or by identifying local duplications within a sequence. Other programs provide information on the statistical significance of an alignment.like BLAST, FASTA can be used to infer functional and evolutionary relationships between sequences as well as help identify members of gene families. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm. SSEARCH - search for similarity between a query sequence and a group of sequences of the same type (nucleic acid or protein).
2 Another searching tools: GGSEARCH performs optimal global-global alignment searches using the Needleman- Wunsch algorithm. GLSEARCH performs an optimal sequence search using alignments that are global in the query but local in the database sequence. This can be useful when you want to match all of a short query sequence to part of a larger database sequence. FASTA Sequence Format in NCBI (Faiz) eg: The description part is differentiate from the sequence data by a greater-than (">") symbol in the first column.
3 Following after the > symbol,it is the identifier. and the rest of the line is the description. Between the ">" and the first letter of the identifier,there should be no space. The details in the description line is separated by the pipe( ) symbol. Following the description line is the sequence in standard one-letter code. Anything other than a valid code would be ignored for example,spaces, tabulators, asterisks and etc And there will be a blank line between the description and the sequence. Sequence should be represented in the standard nucleic acid code and IUB/IUPAC amino acid. Lower case letters are accepted and will be changed to upper-case letters. Meaning of the sequence identifier: gi genbank-identifier number gb AAS gb( genome bank ) accession number E[Murine hepatitis virus] Name of Genome/protein Another Example of FASTA format of sequence identifier on other sevices:
4 FASTA steps Step1:Hashing Finding the exact matches between 2 sequence with ktupvalue(word size) The lower ktup value the slower the searching and more sensitive Hot spot is used given by(i, j), where I and j are the location of query and database sequence respectively difference between I and j value gives value of offset Using similarity of offset positions of words give the region of alignment of the two sequences 10 of the best alignment according to same or different diagonal is saved FASTA also can use PAM250 scoring for aligned residue Example: Hash table
5 Step 2: Rescoring initial regions The 10 of the best alignment from the step 1 are further processed. These alignment is called initial regions Each of the region is rescore using matrix scoring(pam or BLOSUM) The score obtained is reported as int1 Step 3 : Joining diagonals 2 high scoring alignment step2 is joined with a gap to form single larger alignments The score of this alignment is reported as intn There 2 type of penalty gap(gap open penalty & gap extend penalty) The formula for intn: intn= int1-penalty gap
6 Step 4: perform dynamic programming to find optimal alignment The optimal alignment is obtained using Smith-Waterman program(dynamic programming) The score resulting alignment of the dynamic program is reported as opt FASTA steps summary 1. Identify 10 regions shared by 2 sequence 2. Rescore using PAM or BLOSSUM matrix. The rescore is saved as int1 3. Short diagonal is removed and long diagonal are joined by gap. The score for joined region is reported as intn 4. The best alignment is obtained by using s-w dynamic alignment programming give opt value
7 Significance Sequence alignments and database searching are key to all of bioinformatics. Understanding the significance of alignments requires an understanding of statistics and distributions. FASTA results Following is the FASTA output result. It shows the name and the details of the sequence being aligned in the first two or three rows. Followed by the statistics values that has calculated based on the alignment. Statistics values shown included z-score, bit score, expected value, Smith-waterman score and also similarity score.
8 Figure 1 FASTA output result Z-score Z-score is used to measures significance of a score based on the mean and standard deviation of random score distribution. The differentiation of similarity score from the mean of the random score distribution is standardize by the standard deviation of the random score distribution.to calculate the number of library sequences that could obtain score greater than or equal to score obtain in the search, Z-score can be used with extreme value distribution and poisson distribution. The larger the different between the real score and mean( in standard deviation unit), the higher the Z-scores, the more significant it is. As Z-scores is only dependent on sequences itself and independent on the database size, therefore, the can be compared to each other. Because of this, Z-score very useful for doing all-against-all pairwise sequence comparisons and is used instead of other.
9 Figure 2 formula of Z-score Expected value FASTA program can predict the number of sequences that would be expected to output a Z- score that is greater than or equal to the Z-score got in the search using the distribution of the Z-scores in the database purely by chance. This is named as E() or expect value. The Expect value (E) used to describe the number of alignments with a given score thatt are expected to be seem by searching a database of random sequences simply due to chance. With the increases of Score (S), expected value will decreases exponentially.expected value calculation take into consideration the distribution of the score in the database searched, thus it is database specific. The closer the E-value to zero, the more significant the match is. Virtually identical short alignment will get comparatively higher E-values. The higher E-values match with the idea that shorter sequences will have a higher occurring probability in the database purely by chance.increase of Z-score result in reduction in E-value.Sequences with E() values less than 0.01 for protein searches for a search of 10,000 entries protein database are almost homologous. m = Length of query (in nucleotides or amino acids) n = Size of database (in nucleotides or amino acids) K and λ =parameter depend on the matrix used(eg:blosum 62 K=0.14, λ =0.318) s /score S() (depend on E(S) = Kmn e λˢ = similarity score of database sequence and query sequence the matrix used) Bit Score Bit-score is a log-scaled version of a score.
10 Another expected value formula when we have bit score: s = similarity score of database sequence and query sequence(depend of matrix used. eg:blosum 62) K and λ =parameter depend the matrix used m = Length of query (in nucleotides or amino acids) n = Size of database (in nucleotides or amino acids) Bit score used to indicate how good a particular alignment is, level of significance of the alignment increase with the increase of score. Bit score calculation take into account the gaps and substitutions number related with each aligned sequence.the statistical significance of a bit score is based on the query and library sequences length and library size.for instances, 1 bit increase in score, will result in reduction of 2-fold in expectation; while 10 bit increase corresponds to 1000 fold reduction in expectation.as bit scores have been standardized with respect to the scoring system, they can be used to compare alignment scores from different searches. Smith-waterman Score Smith-waterman score is a parameter used to evaluate similar regions between two nucleotides or protein sequences. Instead of depend on the full pictures of the sequence, Smith-Waterman algorithm compares segments of all possible lengths and optimizes the likeness measure. The higher the Smith-waterman score, the more significant the protein sequence. It could be used to identify conserved domains in proteins, whichh may not extend over the entire sequence. Evaluating of result Best score initn: 952 init1: 952 opt: 952 Z-score: bits: E() ): 2.7e-52
11 Smith-Waterman score: 952; 100.0% identity (100% similar) in 148 aa overlap (1-148:1-148) Above is the best score result, as it have similarity and identity of 100%. Besides, it has an extremely high Z-score which is bits and very low expected value, 2.7e-52 which shows very high significance of the sequence, very high bits score of that shows it is a very good alignment and extremely high Smith-Waterman score which is 952 that shows high local sequences and shows the very high significance of the sequence. Good score initn: 438 init1: 161 opt: 418 Z-score: bits: E(): 5.1e-21 Smith- Waterman score: 531; 72.4% identity (74.5% similar) in 145 aa overlap (1-116:2-141) Above is the good score result, as it have similarity and identity of 74.5% and 72.4% respectively. Besides, it has a high Z-score which is bits and low expected value, 5.1e-21 which show high significance of the sequence, high bits score of that shows it is a good alignment and high Smith-Waterman score which is 531 that shows high local sequences and shows the high significance of the sequence. Mediocre score initn: 250 init1: 107 opt: 167 Z-score: bits: 53.3 E(): 1.6e-05 Smith-Waterman score: 233; 53.6% identity (58.0% similar) in 112 aa overlap (1-75:2-113) Above is the mediocre score result, as it have mediocre similarity and identity of 58.0% and 53.6% respectively. Besides, it has amoderate Z-score which is bits and mediocre expected value, 1.6e-05 which show medium significance of the sequence, moderate bits score of 53.3 that shows it is a mediocre alignment and moderate Smith-Waterman score which is 233 that shows intermediate local sequences and shows the medium significance of the sequence. 1.1 FASTA program Sample of FASTA program on EMBL-EBI website :
12 Figure 3 FASTA program in EMBL-EBI Demo They are 4 step to used fasta. 1. Select the databank 2. Input protein /DNA/RNA sequence 3. Set parameter 4. Submit the job
13 Step 1: Select databank Can select multiple databases. The database will run the sequence. Eg: Step 2 : input protein/dna The sequence can be be in GCG, FASTA, EMBL, GenBank, PIR, NBRF, PHYLIP or UniProtKB/Swiss-Prot format.
14 Step 3: Set Parameters 1) Choose Program: FASTA TFASX TFASY 2) Matric used 1. BLOSUM50 2. BLOSUM62 3. BLASTP62 4. BLOSUM80 5. PAM PAM250
15 Gap Open Penalty -12 by protein -16 by DNA Gap Extend Penalty -2 for protein -4 for DNA What is GAP? maximal consecutive run of spaces. an atomic insertion or deletion of a substring. when gap is too low, high sequence allignment is achievable. Causes of gaps: A single mutation can create a gap (very common). Unequal crossover in meiosis can lead to insertion or deletion of strings of bases. DNA slippage in the replication procedure can result in the repetition of a string. Retrovirus insertions. Translocations of DNA between chromosomes Gaps can occur : Before the first character of a string Inside a string After the last character of a string
16 4) Ktup To limit the word length of search. Use 2 for protein database. 5) Expectation Upper Limit Set the expectation value limit for score and alignment. Sequence with E() scores less than 0.01 is almost hologous. 6) Expectation Lower Limit Set the expectation value limit for score and alignment. this option will filter out the best matches and allow more distant relationships to be displayed. 6) Strand choose which DNA strand to search with when you are using a DNA sequence to compare against the DNA databanks. not required for protein/protein searches
17 Top sequence- will be searched as it is input. Bottom sequence- reverse and complement your input sequence. 7) Histogram Turn on/off the histogram in the FASTA result. The histogram gives a qualitative view of how well the statistical theory fits the similarity scores calculated by the program. 8) Filter filter out unwanted segments of sequence. For example, filtering repeat regions out of your query sequence. Thus, it can reduce the reporting of un-related sequences that match by chance. 9) Scores Maximum number of match summary result search Default value is: 50 10) Alignments - Maximum number of match alignments report result - Default value is: 50
18 11) Sequence Range Specify a range or section of the input sequence to use in the search. Example: Specifying '35-90' in an input sequence of total length 100. Default value is: START-END 12) Database Range Specify the sizes of the sequences search in a database. For example: will search all sequences in a database with length between 100 and 250. Default value is: START-END STEP 4 : Submit Job
19 COMPARISON FASTA VS BLAST FASTA BLAST Fast A 1985 for protein, later modified to conduct search on DNA Basic Local Alignment Search Tool Developed in 1990 SIMILARITIES Both software compare biological sequences of DNA, amino acids, proteins and nucleotides of different species and look for the similarities BLAST use input data in FASTA format Both very fast, viable and saving time DIFFERENCES Cannot be modified Better for dissimilar sequence Can be modified Better for closely matched sequence BLAST faster than FASTA BLAST more accurate than FASTA BLAST more versatile and widely used than FASTA
Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.
Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the
More informationAs of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be
48 Bioinformatics I, WS 09-10, S. Henz (script by D. Huson) November 26, 2009 4 BLAST and BLAT Outline of the chapter: 1. Heuristics for the pairwise local alignment of two sequences 2. BLAST: search and
More informationBioinformatics for Biologists
Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover
More information24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:
24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid
More informationFastA & the chaining problem
FastA & the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 1 Sources for this lecture: Lectures by Volker Heun, Daniel Huson and Knut Reinert,
More informationBLAST, Profile, and PSI-BLAST
BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources
More informationFastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:
FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:56 4001 4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem
More informationBiology 644: Bioinformatics
Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find
More informationComputational Molecular Biology
Computational Molecular Biology Erwin M. Bakker Lecture 3, mainly from material by R. Shamir [2] and H.J. Hoogeboom [4]. 1 Pairwise Sequence Alignment Biological Motivation Algorithmic Aspect Recursive
More informationLecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:
Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating
More informationLectures by Volker Heun, Daniel Huson and Knut Reinert, in particular last years lectures
4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 4.1 Sources for this lecture Lectures by Volker Heun, Daniel Huson and Knut
More informationSequence Alignment & Search
Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version
More informationAn Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST
An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise
More informationCISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Sequence pairwise alignment Score statistics: E-value and p-value Heuristic algorithms: BLAST and FASTA Database search: gene finding and annotations
More informationBLAST MCDB 187. Friday, February 8, 13
BLAST MCDB 187 BLAST Basic Local Alignment Sequence Tool Uses shortcut to compute alignments of a sequence against a database very quickly Typically takes about a minute to align a sequence against a database
More informationFinding homologous sequences in databases
Finding homologous sequences in databases There are multiple algorithms to search sequences databases BLAST (EMBL, NCBI, DDBJ, local) FASTA (EMBL, local) For protein only databases scan via Smith-Waterman
More informationBasic Local Alignment Search Tool (BLAST)
BLAST 26.04.2018 Basic Local Alignment Search Tool (BLAST) BLAST (Altshul-1990) is an heuristic Pairwise Alignment composed by six-steps that search for local similarities. The most used access point to
More informationLecture 4: January 1, Biological Databases and Retrieval Systems
Algorithms for Molecular Biology Fall Semester, 1998 Lecture 4: January 1, 1999 Lecturer: Irit Orr Scribe: Irit Gat and Tal Kohen 4.1 Biological Databases and Retrieval Systems In recent years, biological
More informationBioinformatics explained: BLAST. March 8, 2007
Bioinformatics Explained Bioinformatics explained: BLAST March 8, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com Bioinformatics
More informationUtility of Sliding Window FASTA in Predicting Cross- Reactivity with Allergenic Proteins. Bob Cressman Pioneer Crop Genetics
Utility of Sliding Window FASTA in Predicting Cross- Reactivity with Allergenic Proteins Bob Cressman Pioneer Crop Genetics The issue FAO/WHO 2001 Step 2: prepare a complete set of 80-amino acid length
More informationSequence alignment theory and applications Session 3: BLAST algorithm
Sequence alignment theory and applications Session 3: BLAST algorithm Introduction to Bioinformatics online course : IBT Sonal Henson Learning Objectives Understand the principles of the BLAST algorithm
More informationBLAST. NCBI BLAST Basic Local Alignment Search Tool
BLAST NCBI BLAST Basic Local Alignment Search Tool http://www.ncbi.nlm.nih.gov/blast/ Global versus local alignments Global alignments: Attempt to align every residue in every sequence, Most useful when
More informationDynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014
Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into
More informationSequence analysis Pairwise sequence alignment
UMF11 Introduction to bioinformatics, 25 Sequence analysis Pairwise sequence alignment 1. Sequence alignment Lecturer: Marina lexandersson 12 September, 25 here are two types of sequence alignments, global
More informationScoring and heuristic methods for sequence alignment CG 17
Scoring and heuristic methods for sequence alignment CG 17 Amino Acid Substitution Matrices Used to score alignments. Reflect evolution of sequences. Unitary Matrix: M ij = 1 i=j { 0 o/w Genetic Code Matrix:
More informationPairwise Sequence Alignment. Zhongming Zhao, PhD
Pairwise Sequence Alignment Zhongming Zhao, PhD Email: zhongming.zhao@vanderbilt.edu http://bioinfo.mc.vanderbilt.edu/ Sequence Similarity match mismatch A T T A C G C G T A C C A T A T T A T G C G A T
More informationICB Fall G4120: Introduction to Computational Biology. Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology
ICB Fall 2008 G4120: Computational Biology Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology Copyright 2008 Oliver Jovanovic, All Rights Reserved. The Digital Language of Computers
More informationLecture 5 Advanced BLAST
Introduction to Bioinformatics for Medical Research Gideon Greenspan gdg@cs.technion.ac.il Lecture 5 Advanced BLAST BLAST Recap Sequence Alignment Complexity and indexing BLASTN and BLASTP Basic parameters
More informationSequence Alignment (chapter 6) p The biological problem p Global alignment p Local alignment p Multiple alignment
Sequence lignment (chapter 6) p The biological problem p lobal alignment p Local alignment p Multiple alignment Local alignment: rationale p Otherwise dissimilar proteins may have local regions of similarity
More informationDynamic Programming & Smith-Waterman algorithm
m m Seminar: Classical Papers in Bioinformatics May 3rd, 2010 m m 1 2 3 m m Introduction m Definition is a method of solving problems by breaking them down into simpler steps problem need to contain overlapping
More informationBioinformatics. Sequence alignment BLAST Significance. Next time Protein Structure
Bioinformatics Sequence alignment BLAST Significance Next time Protein Structure 1 Experimental origins of sequence data The Sanger dideoxynucleotide method F Each color is one lane of an electrophoresis
More informationChapter 4: Blast. Chaochun Wei Fall 2014
Course organization Introduction ( Week 1-2) Course introduction A brief introduction to molecular biology A brief introduction to sequence comparison Part I: Algorithms for Sequence Analysis (Week 3-11)
More informationSimilarity Searches on Sequence Databases
Similarity Searches on Sequence Databases Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Zürich, October 2004 Swiss Institute of Bioinformatics Swiss EMBnet node Outline Importance of
More informationDatabase Similarity Searching
An Introduction to Bioinformatics BSC4933/ISC5224 Florida State University Feb. 23, 2009 Database Similarity Searching Steven M. Thompson Florida State University of Department Scientific Computing How
More informationTCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology?
Local Sequence Alignment & Heuristic Local Aligners Lectures 18 Nov 28, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall
More information.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar..
.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. PAM and BLOSUM Matrices Prepared by: Jason Banich and Chris Hoover Background As DNA sequences change and evolve, certain amino acids are more
More informationBioinformatics explained: Smith-Waterman
Bioinformatics Explained Bioinformatics explained: Smith-Waterman May 1, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com
More informationBLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha
BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio. 1990. CS 466 Saurabh Sinha Motivation Sequence homology to a known protein suggest function of newly sequenced protein Bioinformatics
More informationLecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD
Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Assumptions: Biological sequences evolved by evolution. Micro scale changes: For short sequences (e.g. one
More informationCOS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1. Database Searching
COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1 Database Searching In database search, we typically have a large sequence database
More informationSequence Alignment Heuristics
Sequence Alignment Heuristics Some slides from: Iosif Vaisman, GMU mason.gmu.edu/~mmasso/binf630alignment.ppt Serafim Batzoglu, Stanford http://ai.stanford.edu/~serafim/ Geoffrey J. Barton, Oxford Protein
More informationCAP BLAST. BIOINFORMATICS Su-Shing Chen CISE. 8/20/2005 Su-Shing Chen, CISE 1
CAP 5510-6 BLAST BIOINFORMATICS Su-Shing Chen CISE 8/20/2005 Su-Shing Chen, CISE 1 BLAST Basic Local Alignment Prof Search Su-Shing Chen Tool A Fast Pair-wise Alignment and Database Searching Tool 8/20/2005
More informationComputational Genomics and Molecular Biology, Fall
Computational Genomics and Molecular Biology, Fall 2015 1 Sequence Alignment Dannie Durand Pairwise Sequence Alignment The goal of pairwise sequence alignment is to establish a correspondence between the
More informationSimilarity searches in biological sequence databases
Similarity searches in biological sequence databases Volker Flegel september 2004 Page 1 Outline Keyword search in databases General concept Examples SRS Entrez Expasy Similarity searches in databases
More informationDatabase Searching Using BLAST
Mahidol University Objectives SCMI512 Molecular Sequence Analysis Database Searching Using BLAST Lecture 2B After class, students should be able to: explain the FASTA algorithm for database searching explain
More informationHeuristic methods for pairwise alignment:
Bi03c_1 Unit 03c: Heuristic methods for pairwise alignment: k-tuple-methods k-tuple-methods for alignment of pairs of sequences Bi03c_2 dynamic programming is too slow for large databases Use heuristic
More informationBIOL 7020 Special Topics Cell/Molecular: Molecular Phylogenetics. Spring 2010 Section A
BIOL 7020 Special Topics Cell/Molecular: Molecular Phylogenetics. Spring 2010 Section A Steve Thompson: stthompson@valdosta.edu http://www.bioinfo4u.net 1 Similarity searching and homology First, just
More informationBLAST - Basic Local Alignment Search Tool
Lecture for ic Bioinformatics (DD2450) April 11, 2013 Searching 1. Input: Query Sequence 2. Database of sequences 3. Subject Sequence(s) 4. Output: High Segment Pairs (HSPs) Sequence Similarity Measures:
More informationVL Algorithmen und Datenstrukturen für Bioinformatik ( ) WS15/2016 Woche 9
VL Algorithmen und Datenstrukturen für Bioinformatik (19400001) WS15/2016 Woche 9 Tim Conrad AG Medical Bioinformatics Institut für Mathematik & Informatik, Freie Universität Berlin Contains material from
More informationCS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores.
CS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores. prepared by Oleksii Kuchaiev, based on presentation by Xiaohui Xie on February 20th. 1 Introduction
More informationCS313 Exercise 4 Cover Page Fall 2017
CS313 Exercise 4 Cover Page Fall 2017 Due by the start of class on Thursday, October 12, 2017. Name(s): In the TIME column, please estimate the time you spent on the parts of this exercise. Please try
More informationAlignment of Pairs of Sequences
Bi03a_1 Unit 03a: Alignment of Pairs of Sequences Partners for alignment Bi03a_2 Protein 1 Protein 2 =amino-acid sequences (20 letter alphabeth + gap) LGPSSKQTGKGS-SRIWDN LN-ITKSAGKGAIMRLGDA -------TGKG--------
More informationComparative Analysis of Protein Alignment Algorithms in Parallel environment using CUDA
Comparative Analysis of Protein Alignment Algorithms in Parallel environment using BLAST versus Smith-Waterman Shadman Fahim shadmanbracu09@gmail.com Shehabul Hossain rudrozzal@gmail.com Gulshan Jubaed
More informationEBI services. Jennifer McDowall EMBL-EBI
EBI services Jennifer McDowall EMBL-EBI The SLING project is funded by the European Commission within Research Infrastructures of the FP7 Capacities Specific Programme, grant agreement number 226073 (Integrating
More informationBLAST & Genome assembly
BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies November 17, 2012 1 Introduction Introduction 2 BLAST What is BLAST? The algorithm 3 Genome assembly De
More informationC E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 13 G R A T I V. Iterative homology searching,
C E N T R E F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U Introduction to bioinformatics 2007 Lecture 13 Iterative homology searching, PSI (Position Specific Iterated) BLAST basic idea use
More informationSequence alignment algorithms
Sequence alignment algorithms Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 23 rd 27 After this lecture, you can decide when to use local and global sequence alignments
More informationB L A S T! BLAST: Basic local alignment search tool. Copyright notice. February 6, Pairwise alignment: key points. Outline of tonight s lecture
February 6, 2008 BLAST: Basic local alignment search tool B L A S T! Jonathan Pevsner, Ph.D. Introduction to Bioinformatics pevsner@jhmi.edu 4.633.0 Copyright notice Many of the images in this powerpoint
More informationBrief review from last class
Sequence Alignment Brief review from last class DNA is has direction, we will use only one (5 -> 3 ) and generate the opposite strand as needed. DNA is a 3D object (see lecture 1) but we will model it
More informationCISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment
CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features
More informationToday s Lecture. Multiple sequence alignment. Improved scoring of pairwise alignments. Affine gap penalties Profiles
Today s Lecture Multiple sequence alignment Improved scoring of pairwise alignments Affine gap penalties Profiles 1 The Edit Graph for a Pair of Sequences G A C G T T G A A T G A C C C A C A T G A C G
More informationPrinciples of Bioinformatics. BIO540/STA569/CSI660 Fall 2010
Principles of Bioinformatics BIO540/STA569/CSI660 Fall 2010 Lecture 11 Multiple Sequence Alignment I Administrivia Administrivia The midterm examination will be Monday, October 18 th, in class. Closed
More informationAlgorithms in Bioinformatics: A Practical Introduction. Database Search
Algorithms in Bioinformatics: A Practical Introduction Database Search Biological databases Biological data is double in size every 15 or 16 months Increasing in number of queries: 40,000 queries per day
More informationBiological Sequence Analysis. CSEP 521: Applied Algorithms Final Project. Archie Russell ( ), Jason Hogg ( )
Biological Sequence Analysis CSEP 521: Applied Algorithms Final Project Archie Russell (0638782), Jason Hogg (0641054) Introduction Background The schematic for every living organism is stored in long
More informationOPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT
OPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT Asif Ali Khan*, Laiq Hassan*, Salim Ullah* ABSTRACT: In bioinformatics, sequence alignment is a common and insistent task. Biologists align
More informationAlgorithmic Approaches for Biological Data, Lecture #20
Algorithmic Approaches for Biological Data, Lecture #20 Katherine St. John City University of New York American Museum of Natural History 20 April 2016 Outline Aligning with Gaps and Substitution Matrices
More informationDistributed Protein Sequence Alignment
Distributed Protein Sequence Alignment ABSTRACT J. Michael Meehan meehan@wwu.edu James Hearne hearne@wwu.edu Given the explosive growth of biological sequence databases and the computational complexity
More informationReconstructing long sequences from overlapping sequence fragment. Searching databases for related sequences and subsequences
SEQUENCE ALIGNMENT ALGORITHMS 1 Why compare sequences? Reconstructing long sequences from overlapping sequence fragment Searching databases for related sequences and subsequences Storing, retrieving and
More informationAlignment of Long Sequences
Alignment of Long Sequences BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2009 Mark Craven craven@biostat.wisc.edu Pairwise Whole Genome Alignment: Task Definition Given a pair of genomes (or other large-scale
More informationSequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC--
Sequence Alignment Sequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC-- TAG-CTATCAC--GACCGC--GGTCGATTTGCCCGAC Distance from sequences
More informationBIOINFORMATICS A PRACTICAL GUIDE TO THE ANALYSIS OF GENES AND PROTEINS
BIOINFORMATICS A PRACTICAL GUIDE TO THE ANALYSIS OF GENES AND PROTEINS EDITED BY Genome Technology Branch National Human Genome Research Institute National Institutes of Health Bethesda, Maryland B. F.
More informationWilson Leung 01/03/2018 An Introduction to NCBI BLAST. Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment
An Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at https://blast.ncbi.nlm.nih.gov/blast.cgi
More informationIntroduction to Phylogenetics Week 2. Databases and Sequence Formats
Introduction to Phylogenetics Week 2 Databases and Sequence Formats I. Databases Crucial to bioinformatics The bigger the database, the more comparative research data Requires scientists to upload data
More informationResearch Article International Journals of Advanced Research in Computer Science and Software Engineering ISSN: X (Volume-7, Issue-6)
International Journals of Advanced Research in Computer Science and Software Engineering ISSN: 77-18X (Volume-7, Issue-6) Research Article June 017 DDGARM: Dotlet Driven Global Alignment with Reduced Matrix
More informationGPU Accelerated Smith-Waterman
GPU Accelerated Smith-Waterman Yang Liu 1,WayneHuang 1,2, John Johnson 1, and Sheila Vaidya 1 1 Lawrence Livermore National Laboratory 2 DOE Joint Genome Institute, UCRL-CONF-218814 {liu24, whuang, jjohnson,
More informationTutorial 4 BLAST Searching the CHO Genome
Tutorial 4 BLAST Searching the CHO Genome Accessing the CHO Genome BLAST Tool The CHO BLAST server can be accessed by clicking on the BLAST button on the home page or by selecting BLAST from the menu bar
More informationUSING AN EXTENDED SUFFIX TREE TO SPEED-UP SEQUENCE ALIGNMENT
IADIS International Conference Applied Computing 2006 USING AN EXTENDED SUFFIX TREE TO SPEED-UP SEQUENCE ALIGNMENT Divya R. Singh Software Engineer Microsoft Corporation, Redmond, WA 98052, USA Abdullah
More informationBGGN 213 Foundations of Bioinformatics Barry Grant
BGGN 213 Foundations of Bioinformatics Barry Grant http://thegrantlab.org/bggn213 Recap From Last Time: 25 Responses: https://tinyurl.com/bggn213-02-f17 Why ALIGNMENT FOUNDATIONS Why compare biological
More informationPreliminary Syllabus. Genomics. Introduction & Genome Assembly Sequence Comparison Gene Modeling Gene Function Identification
Preliminary Syllabus Sep 30 Oct 2 Oct 7 Oct 9 Oct 14 Oct 16 Oct 21 Oct 25 Oct 28 Nov 4 Nov 8 Introduction & Genome Assembly Sequence Comparison Gene Modeling Gene Function Identification OCTOBER BREAK
More informationGlobal Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties
Global Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties From LCS to Alignment: Change the Scoring The Longest Common Subsequence (LCS) problem the simplest form of sequence
More informationNew generation of patent sequence databases Information Sources in Biotechnology Japan
New generation of patent sequence databases Information Sources in Biotechnology Japan EBI is an Outstation of the European Molecular Biology Laboratory. Patent-related resources Patents Patent Resources
More information- G T G T A C A C
Name Student ID.. Sequence alignment 1. Globally align sequence V (GTGTACAC) and sequence W (GTACC) by hand using dynamic programming algorithm. The alignment will be performed based on match premium of
More informationFINDING APPROXIMATE REPEATS WITH MULTIPLE SPACED SEEDS
FINDING APPROXIMATE REPEATS WITH MULTIPLE SPACED SEEDS FINDING APPROXIMATE REPEATS IN DNA SEQUENCES USING MULTIPLE SPACED SEEDS By SARAH BANYASSADY, B.S. A Thesis Submitted to the School of Graduate Studies
More informationBioinformatics Sequence comparison 2 local pairwise alignment
Bioinformatics Sequence comparison 2 local pairwise alignment David Gilbert Bioinformatics Research Centre www.brc.dcs.gla.ac.uk Department of Computing Science, University of Glasgow Lecture contents
More informationFrom Smith-Waterman to BLAST
From Smith-Waterman to BLAST Jeremy Buhler July 23, 2015 Smith-Waterman is the fundamental tool that we use to decide how similar two sequences are. Isn t that all that BLAST does? In principle, it is
More informationThe Effect of Inverse Document Frequency Weights on Indexed Sequence Retrieval. Kevin C. O'Kane. Department of Computer Science
The Effect of Inverse Document Frequency Weights on Indexed Sequence Retrieval Kevin C. O'Kane Department of Computer Science The University of Northern Iowa Cedar Falls, Iowa okane@cs.uni.edu http://www.cs.uni.edu/~okane
More informationData Mining Technologies for Bioinformatics Sequences
Data Mining Technologies for Bioinformatics Sequences Deepak Garg Computer Science and Engineering Department Thapar Institute of Engineering & Tecnology, Patiala Abstract Main tool used for sequence alignment
More informationA Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity
A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity G. Pratyusha, Department of Computer Science & Engineering, V.R.Siddhartha Engineering College(Autonomous)
More informationBiostatistics and Bioinformatics Molecular Sequence Databases
. 1 Description of Module Subject Name Paper Name Module Name/Title 13 03 Dr. Vijaya Khader Dr. MC Varadaraj 2 1. Objectives: In the present module, the students will learn about 1. Encoding linear sequences
More informationFast Sequence Alignment Method Using CUDA-enabled GPU
Fast Sequence Alignment Method Using CUDA-enabled GPU Yeim-Kuan Chang Department of Computer Science and Information Engineering National Cheng Kung University Tainan, Taiwan ykchang@mail.ncku.edu.tw De-Yu
More informationSequence Alignment. GBIO0002 Archana Bhardwaj University of Liege
Sequence Alignment GBIO0002 Archana Bhardwaj University of Liege 1 What is Sequence Alignment? A sequence alignment is a way of arranging the sequences of DNA, RNA, or protein to identify regions of similarity.
More information) I R L Press Limited, Oxford, England. The protein identification resource (PIR)
Volume 14 Number 1 Volume 1986 Nucleic Acids Research 14 Number 1986 Nucleic Acids Research The protein identification resource (PIR) David G.George, Winona C.Barker and Lois T.Hunt National Biomedical
More informationBLAST & Genome assembly
BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies May 15, 2014 1 BLAST What is BLAST? The algorithm 2 Genome assembly De novo assembly Mapping assembly 3
More informationSequence Alignment. part 2
Sequence Alignment part 2 Dynamic programming with more realistic scoring scheme Using the same initial sequences, we ll look at a dynamic programming example with a scoring scheme that selects for matches
More informationComparison of Sequence Similarity Measures for Distant Evolutionary Relationships
Comparison of Sequence Similarity Measures for Distant Evolutionary Relationships Abhishek Majumdar, Peter Z. Revesz Department of Computer Science and Engineering, University of Nebraska-Lincoln, Lincoln,
More informationAlignments BLAST, BLAT
Alignments BLAST, BLAT Genome Genome Gene vs Built of DNA DNA Describes Organism Protein gene Stored as Circular/ linear Single molecule, or a few of them Both (depending on the species) Part of genome
More informationMetric Indexing of Protein Databases and Promising Approaches
WDS'07 Proceedings of Contributed Papers, Part I, 91 97, 2007. ISBN 978-80-7378-023-4 MATFYZPRESS Metric Indexing of Protein Databases and Promising Approaches D. Hoksza Charles University, Faculty of
More informationPROTEIN MULTIPLE ALIGNMENT MOTIVATION: BACKGROUND: Marina Sirota
Marina Sirota MOTIVATION: PROTEIN MULTIPLE ALIGNMENT To study evolution on the genetic level across a wide range of organisms, biologists need accurate tools for multiple sequence alignment of protein
More informationMultiple Sequence Alignment. Mark Whitsitt - NCSA
Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 04: Variations of sequence alignments http://www.pitt.edu/~mcs2/teaching/biocomp/tutorials/global.html Slides adapted from Dr. Shaojie Zhang (University
More information