BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha

Size: px
Start display at page:

Download "BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha"

Transcription

1 BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha

2 Motivation Sequence homology to a known protein suggest function of newly sequenced protein Bioinformatics task is to find homologous sequence in a database of sequences Databases of sequences growing fast

3 Alignment Natural approach to check if the query sequence is homologous to a sequence in the database is to compute alignment score of the two sequences Alignment score counts gaps (insertions, deletions) and replacements Minimizing the evolutionary distance

4 Alignment Global alignment: optimize the overall similarity of the two sequences Local alignment: find only relatively conserved subsequences Local similarity measures preferred for database searches Distantly related proteins may only share isolated regions of similarity

5 Alignment Dynamic programming is the standard approach to sequence alignment Algorithm is quadratic in length of the two sequences Not practical for searches against very large database of sequences (e.g., whole genome)

6 Scoring alignments Scoring matrix: 4 x 4 matrix (DNA) or 20 x 20 matrix (protein) Amino acid sequences: PAM matrix Consider amino acid sequence alignment for very closely related proteins, extract replacement frequencies (probabilities), extrapolate to greater evolutionary distances DNA sequences: match = +5, mismatch = -4

7 BLAST: the MSP Given two sequences of same length, the similarity score of their alignment (without gaps) is the sum of similarity values for each pair of aligned residues Maximal segment pair (MSP): Highest scoring pair of identical length segments from the two sequences The similarity score of an MSP is called the MSP score BLAST heuristically aims to find this

8 Locally maximal segment pair A molecular biologist may be interested in all conserved regions shared by two proteins, not just their highest scoring pair A segment pair (segments of identical lengths) is locally maximal if its score cannot be improved by extending or shortening in either direction BLAST attempts to find all locally maximal segment pairs above some score cutoff.

9 Rapid approximation of MSP score Goal is to report those database sequences that have MSP score above some threshold S. Statistics tells us what is the highest threshold S at which chance similarities are likely to appear Tractability to statistical analysis is one of the attractive features of the MSP score

10 Rapid approximation of MSP score BLAST minimizes time spent on database sequences whose similarity with the query has little chance of exceeding this cutoff S. Main strategy: seek only segment pairs (one from database, one query) that contain a word pair with score >= T Intuition: If the sequence pair has to score above S, its most well matched word (of some predetermined small length) must score above T Lower T => Fewer false negatives Lower T => More pairs to analyze

11 Implementation 1. Compile a list of high scoring words 2. Scan database for hits to this word list 3. Extend hits

12 Step 1: Compiling list of words from query sequence For proteins: List of all w-length words that score at least T when compared to some word in query sequence Question: Does every word in the query sequence make it to the list? For DNA: list of all w-length words in the query sequence, often with w=12

13 Step 2: Scanning the database for hits Find exact matches to list words Can be done in linear time two methods (next slides) Each word in list points to all occurrences of the word in word list from previous step

14 Scanning the database for hits Method 1: Let w=4, so 20 4 possible words Each integer in is an index for an array Array element point to list of all occurrences of that word in query Not all 20 4 elements of array are populated only the ones in word list from previous step

15 Scanning the database for hits Method 2: use deterministic finite automaton or finite state machine. Similar to the keyword trees seen in course. Build the finite state machine out of all words in word list from previous step

16 Step 3: Extending hits Once a word pair with score >= T has been found, extend it in each direction. Extend until score >= S is obtained During extension, score may go up, and then down, and then up again Terminate if it goes down too much (a certain distance below the best score found for shorter extensions) One implementation allows gaps during extension

17 BLAST: approximating the MSP BLAST may not find all segment pairs above threshold S Trying to approximate the MSP Bounds on the error: not hard bounds, but statistical bounds Highly likely to find the MSP

18 Statistics Suppose the MSP has been calculated by BLAST (and suppose this is the true MSP) Suppose this observed MSP scores S. What are the chances that the MSP score for two unrelated sequences would be >= S? If the chances are very low, then we can be confident that the two sequences must not have been unrelated

19 Statistics Given two random sequences of lengths m and n Probability that they will produce an MSP score of >= x?

20 Statistics Number of separate SPs with score >= x is Poisson distributed with mean y(x) = Kmn exp(-λx), where λ is the positive solution of p i p j exp(λs(i,j)) = 1 K is a constant s(i,j) is the scoring matrix, p i is the frequency of i in random sequences

21 Statistics Poisson distribution: Pr(x) = (e - λ λ x )/x! Pr(#SPs >= α) = 1 - Pr(#SPs <= α-1) =1" #"1 $ i= 0 e "y y i i! #"1 $ i= 0 =1" e "y y i i!

22 Statistics For α=1, Pr(#SPs >= 1) = 1-e -y(x) Choose S such that 1-e -y(s) is small Suppose the probability of having at least 1 SP with score >= S is This seems reasonably small However, if you test random sequences, you expect 10 to cross the threshold Therefore, require E-value to be small. That is, expected number of random sequence pairs with score >= S should be small.

23 More statistics We just saw how to choose threshold S How to choose T? BLAST is trying to find segment pairs (SPs) scoring above S If an SP scores S, what is the probability that it will have a w-word match of score T or more? We want this probability to be high

24 More statistics: Choosing T Given a segment pair (from two random sequences) that scores S, what is the probability q that it will have no w-word match scoring above T? Want this q to be low Obtained from simulations Found to decrease exponentially as S increases

25 BLAST is the universally used bioinformatics tool

26

BLAST, Profile, and PSI-BLAST

BLAST, Profile, and PSI-BLAST BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources

More information

BLAST - Basic Local Alignment Search Tool

BLAST - Basic Local Alignment Search Tool Lecture for ic Bioinformatics (DD2450) April 11, 2013 Searching 1. Input: Query Sequence 2. Database of sequences 3. Subject Sequence(s) 4. Output: High Segment Pairs (HSPs) Sequence Similarity Measures:

More information

24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:

24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading: 24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid

More information

COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1. Database Searching

COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1. Database Searching COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1 Database Searching In database search, we typically have a large sequence database

More information

An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST

An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise

More information

Computational Molecular Biology

Computational Molecular Biology Computational Molecular Biology Erwin M. Bakker Lecture 3, mainly from material by R. Shamir [2] and H.J. Hoogeboom [4]. 1 Pairwise Sequence Alignment Biological Motivation Algorithmic Aspect Recursive

More information

Heuristic methods for pairwise alignment:

Heuristic methods for pairwise alignment: Bi03c_1 Unit 03c: Heuristic methods for pairwise alignment: k-tuple-methods k-tuple-methods for alignment of pairs of sequences Bi03c_2 dynamic programming is too slow for large databases Use heuristic

More information

Bioinformatics explained: BLAST. March 8, 2007

Bioinformatics explained: BLAST. March 8, 2007 Bioinformatics Explained Bioinformatics explained: BLAST March 8, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com Bioinformatics

More information

CS313 Exercise 4 Cover Page Fall 2017

CS313 Exercise 4 Cover Page Fall 2017 CS313 Exercise 4 Cover Page Fall 2017 Due by the start of class on Thursday, October 12, 2017. Name(s): In the TIME column, please estimate the time you spent on the parts of this exercise. Please try

More information

Introduction to Computational Molecular Biology

Introduction to Computational Molecular Biology 18.417 Introduction to Computational Molecular Biology Lecture 13: October 21, 2004 Scribe: Eitan Reich Lecturer: Ross Lippert Editor: Peter Lee 13.1 Introduction We have been looking at algorithms to

More information

As of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be

As of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be 48 Bioinformatics I, WS 09-10, S. Henz (script by D. Huson) November 26, 2009 4 BLAST and BLAT Outline of the chapter: 1. Heuristics for the pairwise local alignment of two sequences 2. BLAST: search and

More information

Sequence alignment theory and applications Session 3: BLAST algorithm

Sequence alignment theory and applications Session 3: BLAST algorithm Sequence alignment theory and applications Session 3: BLAST algorithm Introduction to Bioinformatics online course : IBT Sonal Henson Learning Objectives Understand the principles of the BLAST algorithm

More information

Database Searching Using BLAST

Database Searching Using BLAST Mahidol University Objectives SCMI512 Molecular Sequence Analysis Database Searching Using BLAST Lecture 2B After class, students should be able to: explain the FASTA algorithm for database searching explain

More information

CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment

CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features

More information

Bioinformatics explained: Smith-Waterman

Bioinformatics explained: Smith-Waterman Bioinformatics Explained Bioinformatics explained: Smith-Waterman May 1, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com

More information

Introduction to BLAST with Protein Sequences. Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2

Introduction to BLAST with Protein Sequences. Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2 Introduction to BLAST with Protein Sequences Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2 1 References Chapter 2 of Biological Sequence Analysis (Durbin et al., 2001)

More information

Data Mining Technologies for Bioinformatics Sequences

Data Mining Technologies for Bioinformatics Sequences Data Mining Technologies for Bioinformatics Sequences Deepak Garg Computer Science and Engineering Department Thapar Institute of Engineering & Tecnology, Patiala Abstract Main tool used for sequence alignment

More information

Preliminary Syllabus. Genomics. Introduction & Genome Assembly Sequence Comparison Gene Modeling Gene Function Identification

Preliminary Syllabus. Genomics. Introduction & Genome Assembly Sequence Comparison Gene Modeling Gene Function Identification Preliminary Syllabus Sep 30 Oct 2 Oct 7 Oct 9 Oct 14 Oct 16 Oct 21 Oct 25 Oct 28 Nov 4 Nov 8 Introduction & Genome Assembly Sequence Comparison Gene Modeling Gene Function Identification OCTOBER BREAK

More information

Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.

Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the

More information

BLAST MCDB 187. Friday, February 8, 13

BLAST MCDB 187. Friday, February 8, 13 BLAST MCDB 187 BLAST Basic Local Alignment Sequence Tool Uses shortcut to compute alignments of a sequence against a database very quickly Typically takes about a minute to align a sequence against a database

More information

C E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 13 G R A T I V. Iterative homology searching,

C E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 13 G R A T I V. Iterative homology searching, C E N T R E F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U Introduction to bioinformatics 2007 Lecture 13 Iterative homology searching, PSI (Position Specific Iterated) BLAST basic idea use

More information

Biology 644: Bioinformatics

Biology 644: Bioinformatics Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find

More information

Bioinformatics. Sequence alignment BLAST Significance. Next time Protein Structure

Bioinformatics. Sequence alignment BLAST Significance. Next time Protein Structure Bioinformatics Sequence alignment BLAST Significance Next time Protein Structure 1 Experimental origins of sequence data The Sanger dideoxynucleotide method F Each color is one lane of an electrophoresis

More information

Bioinformatics for Biologists

Bioinformatics for Biologists Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover

More information

Principles of Bioinformatics. BIO540/STA569/CSI660 Fall 2010

Principles of Bioinformatics. BIO540/STA569/CSI660 Fall 2010 Principles of Bioinformatics BIO540/STA569/CSI660 Fall 2010 Lecture 11 Multiple Sequence Alignment I Administrivia Administrivia The midterm examination will be Monday, October 18 th, in class. Closed

More information

CISC 636 Computational Biology & Bioinformatics (Fall 2016)

CISC 636 Computational Biology & Bioinformatics (Fall 2016) CISC 636 Computational Biology & Bioinformatics (Fall 2016) Sequence pairwise alignment Score statistics: E-value and p-value Heuristic algorithms: BLAST and FASTA Database search: gene finding and annotations

More information

B L A S T! BLAST: Basic local alignment search tool. Copyright notice. February 6, Pairwise alignment: key points. Outline of tonight s lecture

B L A S T! BLAST: Basic local alignment search tool. Copyright notice. February 6, Pairwise alignment: key points. Outline of tonight s lecture February 6, 2008 BLAST: Basic local alignment search tool B L A S T! Jonathan Pevsner, Ph.D. Introduction to Bioinformatics pevsner@jhmi.edu 4.633.0 Copyright notice Many of the images in this powerpoint

More information

GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment

GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment Scoring Dynamic Programming algorithms Heuristic algorithms CLUSTAL W Courtesy of jalview Motivations Collective (or aggregate) statistic

More information

Basic Local Alignment Search Tool (BLAST)

Basic Local Alignment Search Tool (BLAST) BLAST 26.04.2018 Basic Local Alignment Search Tool (BLAST) BLAST (Altshul-1990) is an heuristic Pairwise Alignment composed by six-steps that search for local similarities. The most used access point to

More information

Multiple Sequence Alignment: Multidimensional. Biological Motivation

Multiple Sequence Alignment: Multidimensional. Biological Motivation Multiple Sequence Alignment: Multidimensional Dynamic Programming Boston University Biological Motivation Compare a new sequence with the sequences in a protein family. Proteins can be categorized into

More information

Lecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:

Lecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations: Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating

More information

Lecture 5 Advanced BLAST

Lecture 5 Advanced BLAST Introduction to Bioinformatics for Medical Research Gideon Greenspan gdg@cs.technion.ac.il Lecture 5 Advanced BLAST BLAST Recap Sequence Alignment Complexity and indexing BLASTN and BLASTP Basic parameters

More information

Scoring and heuristic methods for sequence alignment CG 17

Scoring and heuristic methods for sequence alignment CG 17 Scoring and heuristic methods for sequence alignment CG 17 Amino Acid Substitution Matrices Used to score alignments. Reflect evolution of sequences. Unitary Matrix: M ij = 1 i=j { 0 o/w Genetic Code Matrix:

More information

Pairwise Sequence Alignment. Zhongming Zhao, PhD

Pairwise Sequence Alignment. Zhongming Zhao, PhD Pairwise Sequence Alignment Zhongming Zhao, PhD Email: zhongming.zhao@vanderbilt.edu http://bioinfo.mc.vanderbilt.edu/ Sequence Similarity match mismatch A T T A C G C G T A C C A T A T T A T G C G A T

More information

Sequence Alignment & Search

Sequence Alignment & Search Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version

More information

CAP BLAST. BIOINFORMATICS Su-Shing Chen CISE. 8/20/2005 Su-Shing Chen, CISE 1

CAP BLAST. BIOINFORMATICS Su-Shing Chen CISE. 8/20/2005 Su-Shing Chen, CISE 1 CAP 5510-6 BLAST BIOINFORMATICS Su-Shing Chen CISE 8/20/2005 Su-Shing Chen, CISE 1 BLAST Basic Local Alignment Prof Search Su-Shing Chen Tool A Fast Pair-wise Alignment and Database Searching Tool 8/20/2005

More information

FASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm.

FASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm. FASTA INTRODUCTION Definition (by David J. Lipman and William R. Pearson in 1985) - Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence

More information

From Smith-Waterman to BLAST

From Smith-Waterman to BLAST From Smith-Waterman to BLAST Jeremy Buhler July 23, 2015 Smith-Waterman is the fundamental tool that we use to decide how similar two sequences are. Isn t that all that BLAST does? In principle, it is

More information

Computational Genomics and Molecular Biology, Fall

Computational Genomics and Molecular Biology, Fall Computational Genomics and Molecular Biology, Fall 2015 1 Sequence Alignment Dannie Durand Pairwise Sequence Alignment The goal of pairwise sequence alignment is to establish a correspondence between the

More information

Alignments BLAST, BLAT

Alignments BLAST, BLAT Alignments BLAST, BLAT Genome Genome Gene vs Built of DNA DNA Describes Organism Protein gene Stored as Circular/ linear Single molecule, or a few of them Both (depending on the species) Part of genome

More information

HIDDEN MARKOV MODELS AND SEQUENCE ALIGNMENT

HIDDEN MARKOV MODELS AND SEQUENCE ALIGNMENT HIDDEN MARKOV MODELS AND SEQUENCE ALIGNMENT - Swarbhanu Chatterjee. Hidden Markov models are a sophisticated and flexible statistical tool for the study of protein models. Using HMMs to analyze proteins

More information

BGGN 213 Foundations of Bioinformatics Barry Grant

BGGN 213 Foundations of Bioinformatics Barry Grant BGGN 213 Foundations of Bioinformatics Barry Grant http://thegrantlab.org/bggn213 Recap From Last Time: 25 Responses: https://tinyurl.com/bggn213-02-f17 Why ALIGNMENT FOUNDATIONS Why compare biological

More information

L4: Blast: Alignment Scores etc.

L4: Blast: Alignment Scores etc. L4: Blast: Alignment Scores etc. Why is Blast Fast? Silly Question Prove or Disprove: There are two people in New York City with exactly the same number of hairs. Large database search Database (n) Query

More information

Brief review from last class

Brief review from last class Sequence Alignment Brief review from last class DNA is has direction, we will use only one (5 -> 3 ) and generate the opposite strand as needed. DNA is a 3D object (see lecture 1) but we will model it

More information

Sequence analysis Pairwise sequence alignment

Sequence analysis Pairwise sequence alignment UMF11 Introduction to bioinformatics, 25 Sequence analysis Pairwise sequence alignment 1. Sequence alignment Lecturer: Marina lexandersson 12 September, 25 here are two types of sequence alignments, global

More information

Dynamic Programming: Sequence alignment. CS 466 Saurabh Sinha

Dynamic Programming: Sequence alignment. CS 466 Saurabh Sinha Dynamic Programming: Sequence alignment CS 466 Saurabh Sinha DNA Sequence Comparison: First Success Story Finding sequence similarities with genes of known function is a common approach to infer a newly

More information

.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar..

.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. .. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. PAM and BLOSUM Matrices Prepared by: Jason Banich and Chris Hoover Background As DNA sequences change and evolve, certain amino acids are more

More information

FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:

FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10: FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:56 4001 4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem

More information

BLAST. Basic Local Alignment Search Tool. Used to quickly compare a protein or DNA sequence to a database.

BLAST. Basic Local Alignment Search Tool. Used to quickly compare a protein or DNA sequence to a database. BLAST Basic Local Alignment Search Tool Used to quickly compare a protein or DNA sequence to a database. There is no such thing as a free lunch BLAST is fast and highly sensitive compared to competitors.

More information

Searching Sequence Databases

Searching Sequence Databases Wright State University CORE Scholar Computer Science and Engineering Faculty Publications Computer Science & Engineering 2003 Searching Sequence Databases Dan E. Krane Wright State University - Main Campus,

More information

A Design of a Hybrid System for DNA Sequence Alignment

A Design of a Hybrid System for DNA Sequence Alignment IMECS 2008, 9-2 March, 2008, Hong Kong A Design of a Hybrid System for DNA Sequence Alignment Heba Khaled, Hossam M. Faheem, Tayseer Hasan, Saeed Ghoneimy Abstract This paper describes a parallel algorithm

More information

PROTEIN MULTIPLE ALIGNMENT MOTIVATION: BACKGROUND: Marina Sirota

PROTEIN MULTIPLE ALIGNMENT MOTIVATION: BACKGROUND: Marina Sirota Marina Sirota MOTIVATION: PROTEIN MULTIPLE ALIGNMENT To study evolution on the genetic level across a wide range of organisms, biologists need accurate tools for multiple sequence alignment of protein

More information

USING AN EXTENDED SUFFIX TREE TO SPEED-UP SEQUENCE ALIGNMENT

USING AN EXTENDED SUFFIX TREE TO SPEED-UP SEQUENCE ALIGNMENT IADIS International Conference Applied Computing 2006 USING AN EXTENDED SUFFIX TREE TO SPEED-UP SEQUENCE ALIGNMENT Divya R. Singh Software Engineer Microsoft Corporation, Redmond, WA 98052, USA Abdullah

More information

Similarity Searches on Sequence Databases

Similarity Searches on Sequence Databases Similarity Searches on Sequence Databases Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Zürich, October 2004 Swiss Institute of Bioinformatics Swiss EMBnet node Outline Importance of

More information

FastA & the chaining problem

FastA & the chaining problem FastA & the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 1 Sources for this lecture: Lectures by Volker Heun, Daniel Huson and Knut Reinert,

More information

A CAM(Content Addressable Memory)-based architecture for molecular sequence matching

A CAM(Content Addressable Memory)-based architecture for molecular sequence matching A CAM(Content Addressable Memory)-based architecture for molecular sequence matching P.K. Lala 1 and J.P. Parkerson 2 1 Department Electrical Engineering, Texas A&M University, Texarkana, Texas, USA 2

More information

A Coprocessor Architecture for Fast Protein Structure Prediction

A Coprocessor Architecture for Fast Protein Structure Prediction A Coprocessor Architecture for Fast Protein Structure Prediction M. Marolia, R. Khoja, T. Acharya, C. Chakrabarti Department of Electrical Engineering Arizona State University, Tempe, USA. Abstract Predicting

More information

Biochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA)

Biochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA) Biochemistry 324 Bioinformatics Multiple Sequence Alignment (MSA) Big- Οh notation Greek omicron symbol Ο The Big-Oh notation indicates the complexity of an algorithm in terms of execution speed and storage

More information

Introduction to Phylogenetics Week 2. Databases and Sequence Formats

Introduction to Phylogenetics Week 2. Databases and Sequence Formats Introduction to Phylogenetics Week 2 Databases and Sequence Formats I. Databases Crucial to bioinformatics The bigger the database, the more comparative research data Requires scientists to upload data

More information

A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity

A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity G. Pratyusha, Department of Computer Science & Engineering, V.R.Siddhartha Engineering College(Autonomous)

More information

BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences

BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences Reading in text (Mount Bioinformatics): I must confess that the treatment in Mount of sequence alignment does not seem to me a model

More information

Sequence Alignment Heuristics

Sequence Alignment Heuristics Sequence Alignment Heuristics Some slides from: Iosif Vaisman, GMU mason.gmu.edu/~mmasso/binf630alignment.ppt Serafim Batzoglu, Stanford http://ai.stanford.edu/~serafim/ Geoffrey J. Barton, Oxford Protein

More information

Lecture 5: Multiple sequence alignment

Lecture 5: Multiple sequence alignment Lecture 5: Multiple sequence alignment Introduction to Computational Biology Teresa Przytycka, PhD (with some additions by Martin Vingron) Why do we need multiple sequence alignment Pairwise sequence alignment

More information

JET 2 User Manual 1 INSTALLATION 2 EXECUTION AND FUNCTIONALITIES. 1.1 Download. 1.2 System requirements. 1.3 How to install JET 2

JET 2 User Manual 1 INSTALLATION 2 EXECUTION AND FUNCTIONALITIES. 1.1 Download. 1.2 System requirements. 1.3 How to install JET 2 JET 2 User Manual 1 INSTALLATION 1.1 Download The JET 2 package is available at www.lcqb.upmc.fr/jet2. 1.2 System requirements JET 2 runs on Linux or Mac OS X. The program requires some external tools

More information

Jyoti Lakhani 1, Ajay Khunteta 2, Dharmesh Harwani *3 1 Poornima University, Jaipur & Maharaja Ganga Singh University, Bikaner, Rajasthan, India

Jyoti Lakhani 1, Ajay Khunteta 2, Dharmesh Harwani *3 1 Poornima University, Jaipur & Maharaja Ganga Singh University, Bikaner, Rajasthan, India International Journal of Scientific Research in Computer Science, Engineering and Information Technology 2017 IJSRCSEIT Volume 2 Issue 6 ISSN : 2456-3307 Improvisation of Global Pairwise Sequence Alignment

More information

Combinatorial Pattern Matching. CS 466 Saurabh Sinha

Combinatorial Pattern Matching. CS 466 Saurabh Sinha Combinatorial Pattern Matching CS 466 Saurabh Sinha Genomic Repeats Example of repeats: ATGGTCTAGGTCCTAGTGGTC Motivation to find them: Genomic rearrangements are often associated with repeats Trace evolutionary

More information

Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it.

Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it. Sequence Alignments Overview Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it. Sequence alignment means arranging

More information

TCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology?

TCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology? Local Sequence Alignment & Heuristic Local Aligners Lectures 18 Nov 28, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall

More information

Chapter 4: Blast. Chaochun Wei Fall 2014

Chapter 4: Blast. Chaochun Wei Fall 2014 Course organization Introduction ( Week 1-2) Course introduction A brief introduction to molecular biology A brief introduction to sequence comparison Part I: Algorithms for Sequence Analysis (Week 3-11)

More information

Reconstructing long sequences from overlapping sequence fragment. Searching databases for related sequences and subsequences

Reconstructing long sequences from overlapping sequence fragment. Searching databases for related sequences and subsequences SEQUENCE ALIGNMENT ALGORITHMS 1 Why compare sequences? Reconstructing long sequences from overlapping sequence fragment Searching databases for related sequences and subsequences Storing, retrieving and

More information

CS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores.

CS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores. CS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores. prepared by Oleksii Kuchaiev, based on presentation by Xiaohui Xie on February 20th. 1 Introduction

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 04: Variations of sequence alignments http://www.pitt.edu/~mcs2/teaching/biocomp/tutorials/global.html Slides adapted from Dr. Shaojie Zhang (University

More information

Notes on Dynamic-Programming Sequence Alignment

Notes on Dynamic-Programming Sequence Alignment Notes on Dynamic-Programming Sequence Alignment Introduction. Following its introduction by Needleman and Wunsch (1970), dynamic programming has become the method of choice for rigorous alignment of DNA

More information

Multiple Sequence Alignment. Mark Whitsitt - NCSA

Multiple Sequence Alignment. Mark Whitsitt - NCSA Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV

More information

An I/O device driver for bioinformatics tools: the case for BLAST

An I/O device driver for bioinformatics tools: the case for BLAST An I/O device driver for bioinformatics tools 563 An I/O device driver for bioinformatics tools: the case for BLAST Renato Campos Mauro and Sérgio Lifschitz Departamento de Informática PUC-RIO, Pontifícia

More information

BLAST & Genome assembly

BLAST & Genome assembly BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies May 15, 2014 1 BLAST What is BLAST? The algorithm 2 Genome assembly De novo assembly Mapping assembly 3

More information

Optimizing multiple spaced seeds for homology search

Optimizing multiple spaced seeds for homology search Optimizing multiple spaced seeds for homology search Jinbo Xu Daniel Brown Ming Li Bin Ma Abstract Optimized spaced seeds improve sensitivity and specificity in local homology search. Several authors have

More information

Parsimony-Based Approaches to Inferring Phylogenetic Trees

Parsimony-Based Approaches to Inferring Phylogenetic Trees Parsimony-Based Approaches to Inferring Phylogenetic Trees BMI/CS 576 www.biostat.wisc.edu/bmi576.html Mark Craven craven@biostat.wisc.edu Fall 0 Phylogenetic tree approaches! three general types! distance:

More information

OPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT

OPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT OPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT Asif Ali Khan*, Laiq Hassan*, Salim Ullah* ABSTRACT: In bioinformatics, sequence alignment is a common and insistent task. Biologists align

More information

Multiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences

Multiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences Multiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences Yue Lu and Sing-Hoi Sze RECOMB 2007 Presented by: Wanxing Xu March 6, 2008 Content Biology Motivation Computation Problem

More information

Lectures by Volker Heun, Daniel Huson and Knut Reinert, in particular last years lectures

Lectures by Volker Heun, Daniel Huson and Knut Reinert, in particular last years lectures 4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 4.1 Sources for this lecture Lectures by Volker Heun, Daniel Huson and Knut

More information

INTRODUCTION TO BIOINFORMATICS

INTRODUCTION TO BIOINFORMATICS Molecular Biology-2019 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain

More information

Comparison of Phylogenetic Trees of Multiple Protein Sequence Alignment Methods

Comparison of Phylogenetic Trees of Multiple Protein Sequence Alignment Methods Comparison of Phylogenetic Trees of Multiple Protein Sequence Alignment Methods Khaddouja Boujenfa, Nadia Essoussi, and Mohamed Limam International Science Index, Computer and Information Engineering waset.org/publication/482

More information

Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014

Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into

More information

Tutorial 4 BLAST Searching the CHO Genome

Tutorial 4 BLAST Searching the CHO Genome Tutorial 4 BLAST Searching the CHO Genome Accessing the CHO Genome BLAST Tool The CHO BLAST server can be accessed by clicking on the BLAST button on the home page or by selecting BLAST from the menu bar

More information

INTRODUCTION TO BIOINFORMATICS

INTRODUCTION TO BIOINFORMATICS Molecular Biology-2017 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain

More information

BLAST & Genome assembly

BLAST & Genome assembly BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies November 17, 2012 1 Introduction Introduction 2 BLAST What is BLAST? The algorithm 3 Genome assembly De

More information

Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion.

Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. www.ijarcet.org 54 Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. Hassan Kehinde Bello and Kazeem Alagbe Gbolagade Abstract Biological sequence alignment is becoming popular

More information

15-780: Graduate Artificial Intelligence. Computational biology: Sequence alignment and profile HMMs

15-780: Graduate Artificial Intelligence. Computational biology: Sequence alignment and profile HMMs 5-78: Graduate rtificial Intelligence omputational biology: Sequence alignment and profile HMMs entral dogma DN GGGG transcription mrn UGGUUUGUG translation Protein PEPIDE 2 omparison of Different Organisms

More information

New String Kernels for Biosequence Data

New String Kernels for Biosequence Data Workshop on Kernel Methods in Bioinformatics New String Kernels for Biosequence Data Christina Leslie Department of Computer Science Columbia University Biological Sequence Classification Problems Protein

More information

Towards Declarative and Efficient Querying on Protein Structures

Towards Declarative and Efficient Querying on Protein Structures Towards Declarative and Efficient Querying on Protein Structures Jignesh M. Patel University of Michigan Biology Data Types Sequences: AGCGGTA. Structure: Interaction Maps: Micro-arrays: Gene A Gene B

More information

Alignment of Pairs of Sequences

Alignment of Pairs of Sequences Bi03a_1 Unit 03a: Alignment of Pairs of Sequences Partners for alignment Bi03a_2 Protein 1 Protein 2 =amino-acid sequences (20 letter alphabeth + gap) LGPSSKQTGKGS-SRIWDN LN-ITKSAGKGAIMRLGDA -------TGKG--------

More information

A NEW GENERATION OF HOMOLOGY SEARCH TOOLS BASED ON PROBABILISTIC INFERENCE

A NEW GENERATION OF HOMOLOGY SEARCH TOOLS BASED ON PROBABILISTIC INFERENCE 205 A NEW GENERATION OF HOMOLOGY SEARCH TOOLS BASED ON PROBABILISTIC INFERENCE SEAN R. EDDY 1 eddys@janelia.hhmi.org 1 Janelia Farm Research Campus, Howard Hughes Medical Institute, 19700 Helix Drive,

More information

Module: Sequence Alignment Theory and Applica8ons Session: BLAST

Module: Sequence Alignment Theory and Applica8ons Session: BLAST Module: Sequence Alignment Theory and Applica8ons Session: BLAST Learning Objec8ves and Outcomes v Understand the principles of the BLAST algorithm v Understand the different BLAST algorithms, parameters

More information

3.4 Multiple sequence alignment

3.4 Multiple sequence alignment 3.4 Multiple sequence alignment Why produce a multiple sequence alignment? Using more than two sequences results in a more convincing alignment by revealing conserved regions in ALL of the sequences Aligned

More information

Sequence Alignment. part 2

Sequence Alignment. part 2 Sequence Alignment part 2 Dynamic programming with more realistic scoring scheme Using the same initial sequences, we ll look at a dynamic programming example with a scoring scheme that selects for matches

More information

Dynamic Programming & Smith-Waterman algorithm

Dynamic Programming & Smith-Waterman algorithm m m Seminar: Classical Papers in Bioinformatics May 3rd, 2010 m m 1 2 3 m m Introduction m Definition is a method of solving problems by breaking them down into simpler steps problem need to contain overlapping

More information

Research Article International Journals of Advanced Research in Computer Science and Software Engineering ISSN: X (Volume-7, Issue-6)

Research Article International Journals of Advanced Research in Computer Science and Software Engineering ISSN: X (Volume-7, Issue-6) International Journals of Advanced Research in Computer Science and Software Engineering ISSN: 77-18X (Volume-7, Issue-6) Research Article June 017 DDGARM: Dotlet Driven Global Alignment with Reduced Matrix

More information

Divya R. Singh. Faster Sequence Alignment using Suffix Tree and Data-Mining Techniques. February A Thesis Presented by

Divya R. Singh. Faster Sequence Alignment using Suffix Tree and Data-Mining Techniques. February A Thesis Presented by Faster Sequence Alignment using Suffix Tree and Data-Mining Techniques A Thesis Presented by Divya R. Singh to The Faculty of the Graduate College of the University of Vermont In Partial Fulfillment of

More information

Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD

Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Assumptions: Biological sequences evolved by evolution. Micro scale changes: For short sequences (e.g. one

More information