Sequence Alignment. part 2

Size: px
Start display at page:

Download "Sequence Alignment. part 2"

Transcription

1 Sequence Alignment part 2

2 Dynamic programming with more realistic scoring scheme Using the same initial sequences, we ll look at a dynamic programming example with a scoring scheme that selects for matches and penalizes both mismatched and gaps, as follows: S i,j = 2 if residues match S i,j = -1 if there is a mismatch at the current position w = -2 (gap penalty)

3 Initialization same as before Example sequences: GAATTCAGTTA (sequence 1: M=11) GGATCGA (sequence 2: N=7) G 0 G 0 A 0 T 0 C 0 G 0 A 0 G A A T T C A G T T A

4 Filling matrix (scoring) Recall the scoring scheme: M i,j (matrix position to be filled in) = maximum of these 3 terms: M i-1, j-1 + S i,j (match/mismatch in diagonal) where: o S i,j = 2 for match o S i,j = -1 for mismatch M i, j-1 + w (gap in sequence 1) M i-1,j + w (gap in sequence 2) in either case, w = -2

5 Filling matrix (scoring) Since both sequences start with G, the maximum value for M 1,1 is = 2 for the match G A A T T C A G T T A G 0 2 G 0 A 0 T 0 C 0 G 0 A 0

6 Filling matrix (scoring) Continuing down column 2, we see that the G in the first position of sequence 1 also matches the G in the second position of sequence 2; this means that M1,2 will be the maximum of [2, -2, -2] which is 2 We also add a backward pointing arrow at each position to show where the maximum score came from (see next slide)

7 Filling matrix (scoring) G A A T T C A G T T A G 0 2 G 0 2 A 0 T 0 C 0 G 0 A 0

8 Filling matrix (scoring) At M 1,3 there is no match, so S 1,3 = -1 M 1,3 = MAX[M 0,2-1, M 1,2-2,M 0,3-2] = MAX[-1,0,-2] = 0 G A A T T C A G T T A G 0 2 G 0 2 A 0 0 T 0 C 0 G 0 A 0

9 Filling matrix (scoring) We can continue filling in column 1 using the same reasoning: G A A T T C A G T T A G 0 2 G 0 2 A 0 0 T 0-1 C 0-1 G 0 2 A 0 0

10 Filling matrix (scoring) We continue into column 2: G A A T T C A G T T A G G A T C G A 0 0 4

11 Filling matrix (scoring) At column 3 row 3 we encounter the following situation: M 3,2 = MAX[M 2,1-1, M 3,1-2,M 2,2-2] = MAX[-1,-3,-1] = -1 Since there are 2 different ways we could reach the maximum score, we provide arrows back to both cells that could get us there: G A A T T C A G T T A G G A T C G A 0 0 4

12 Completed matrix G A A T T C A G T T A G G A T C G A

13 Traceback Maximum global alignment is 3, the value in the last row of the last column; traceback step begins here The traceback step is simplified by the presence of the arrows we can follow them to get to the predecessor at each step Since some locations have multiple arrows, we may find multiple alignments, but there will be fewer than under the simple scoring scheme we used before

14 Second possible path Alternate path gives the following alignment: GAATTCAGTTA GGAT-C-G--A

15 Verifying the score(s) Recall our scoring scheme: match: +2 mismatch: -1 gap: -2 Final overall score in table was 3, so alignments should add up to 3, given the above Calculations on next slide verify that they do

16 Verifying the score(s) First alignment: GAATTCAGTTA GGA-TC-G--A = 3 Second alignment: GAATTCAGTTA GGAT-C-G--A = 3

17 Global alignments: pros & cons What they re good for: checking for minor differences between sequences comparing sequences that partly overlap What they re not good for: discovering similarities between 2 sequences exploring similarities within a family of sequences (for this we do multiple alignment)

18 Programming global alignment GA algorithms are based on dynamic programming which is a recursive technique Recursion can be summarized as follows: nature of the problem: must be divisible into smaller subproblems begin by solving the smallest subproblems solutions to smallest problems are used in solutions to larger problems process continues until entire (largest) problem is solved

19 Detailed algorithm: step 1: build scoring matrix 1. Read in 2 sequences to be aligned: lines 7-25 of program 2. Obtain match, mismatch & gap scores (from user): lines Create m+1 x n+1 matrix (see next slide): lines Prepend a blank character to the front of both sequences (so that position 0 of each sequence contains a blank, and sequence indices are consistent with matrix indices): lines 30 & 31

20 Arrays in Perl Array: single variable that holds multiple scalar values individual elements are accessible via index (subscript) one-dimensional array: vector two-dimensional array: matrix

21 Array declaration & notation To distinguish a vector or matrix from a scalar, the starting character of the array = (); # declares empty array We refer to the entire array we reference individual elements using $name and subscript(s): for ($i=0; $i<10; $i++) { $array[$i] = ; } # initializes 10-element vector to blank strings

22 Example program #!/usr/bin/perl # declare = (); # initialize with empty strings: for ($i=0; $i<10; $i++) { $array[$i]=''; } # print it all out backwards: for ($i=9; $i>=0; $i--) { print $array[$i]. "\n"; } # prompt for & read in some data: for ($i=0; $i<10; $i++) { print "Please enter a word or phrase:\n"; $array[$i] = <STDIN>; }

23 Back to algorithm 5. Initialize first row & first column of matrix by adding gap penalty to each successive cell: lines Fill remaining cells (lines 66-99): compute three candidate values for each cell by adding gap penalty or match score (as appropriate) to value in appropriate neighboring cell (lines 80-87) compare the three values to determine maximum score (lines 89-97)

24 Algorithm continued 7. Develop directional string to facilitate traceback: lines unlike the human observer, a program cannot see directional arrows in the matrix instead, we create a string containing directional indicators to develop a traceback path: H indicates left neighbor (horizontal gap) D indicates diagonal neighbor (match/mismatch) V indicates above neighbor (vertical gap)

25 Algorithm continued Perform traceback (lines ): Starting at the right end of each sequence, obtain the current character Read the first (leftmost) character of the directional string & align the retrieved sequence characters as directed Continue until you run out of directional characters

26 Terminal gaps & semiglobal alignments Terminal gaps occur when you align 2 sequences that differ significantly in length; our global alignment algorithm doesn t distinguish between these gaps and internal gaps, even though an alignment with only terminal gaps actually represents the optimal alignment For example, the three alignments below represent what the global alignment would consider optimal: CGCTATAG CGCTATAG CGCTATAG --CTA--- C--TA--- --C--TA- Eliminating the gap penalty for terminal gaps produces a semiglobal alignment

27 Local alignment Many pairs of sequences will include regions of high similarity (conserved regions) interspersed with dissimilar regions A global alignment algorithm on such sequences will result in poor scores and/or many equally (un)likely alignments reported as optimal In such situations, a local alignment algorithm is preferable

28 Local alignment Uses for local alignment: compare distantly-related sequences that share a few non-connected regions in common analysis of repeated elements within a single sequence Smith-Waterman: the original local alignment algorithm

29 Smith-Waterman algorithm Uses scoring system similar to Needleman-Wunsch for building matrix: M i,j = maximum of: 0 or M i-1, j-1 + S i,j or M i-1, j + w or M i, j Note that the inclusion of 0 as a possible maximum eliminates negative values from the matrix FASTA format originated with FASTA algorithm a fast (or fasta ) approximation of Smith-Waterman

30 Online resource for local alignment BLAST: bl2seq Lalign: slower but more accurate than BLAST BLAST returns only best alignment between query & target Lalign returns as many as specified, ranked from best to worst

31 Lalign output % identity within conserved regions length of alignment score: sum of gap/substitution penalties higher score = better alignment E-value better indicator of alignment quality lower = better

32 A look under the hood at BLAST BLAST algorithm splits query sequence into hot spots consisting of: words : short subsequences neighboring words : subsequences similar to words Sequence database is scanned for matches to these hot spots Identified matches used to extend hot spots Uses heuristics to identify best matches

33 BLAST algorithm illustrated

An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST

An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise

More information

Lecture 10. Sequence alignments

Lecture 10. Sequence alignments Lecture 10 Sequence alignments Alignment algorithms: Overview Given a scoring system, we need to have an algorithm for finding an optimal alignment for a pair of sequences. We want to maximize the score

More information

Pairwise Sequence Alignment: Dynamic Programming Algorithms. COMP Spring 2015 Luay Nakhleh, Rice University

Pairwise Sequence Alignment: Dynamic Programming Algorithms. COMP Spring 2015 Luay Nakhleh, Rice University Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 - Spring 2015 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment The number of all possible pairwise alignments (if

More information

Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014

Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into

More information

Sequence analysis Pairwise sequence alignment

Sequence analysis Pairwise sequence alignment UMF11 Introduction to bioinformatics, 25 Sequence analysis Pairwise sequence alignment 1. Sequence alignment Lecturer: Marina lexandersson 12 September, 25 here are two types of sequence alignments, global

More information

Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University

Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University 1 Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment 2 The number of all possible pairwise alignments (if gaps are allowed)

More information

Sequence Comparison: Dynamic Programming. Genome 373 Genomic Informatics Elhanan Borenstein

Sequence Comparison: Dynamic Programming. Genome 373 Genomic Informatics Elhanan Borenstein Sequence omparison: Dynamic Programming Genome 373 Genomic Informatics Elhanan Borenstein quick review: hallenges Find the best global alignment of two sequences Find the best global alignment of multiple

More information

Biology 644: Bioinformatics

Biology 644: Bioinformatics Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find

More information

Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it.

Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it. Sequence Alignments Overview Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it. Sequence alignment means arranging

More information

Rochester Institute of Technology. Making personalized education scalable using Sequence Alignment Algorithm

Rochester Institute of Technology. Making personalized education scalable using Sequence Alignment Algorithm Rochester Institute of Technology Making personalized education scalable using Sequence Alignment Algorithm Submitted by: Lakhan Bhojwani Advisor: Dr. Carlos Rivero 1 1. Abstract There are many ways proposed

More information

BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences

BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences Reading in text (Mount Bioinformatics): I must confess that the treatment in Mount of sequence alignment does not seem to me a model

More information

Programming assignment for the course Sequence Analysis (2006)

Programming assignment for the course Sequence Analysis (2006) Programming assignment for the course Sequence Analysis (2006) Original text by John W. Romein, adapted by Bart van Houte (bart@cs.vu.nl) Introduction Please note: This assignment is only obligatory for

More information

Bioinformatics explained: Smith-Waterman

Bioinformatics explained: Smith-Waterman Bioinformatics Explained Bioinformatics explained: Smith-Waterman May 1, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com

More information

Dynamic Programming & Smith-Waterman algorithm

Dynamic Programming & Smith-Waterman algorithm m m Seminar: Classical Papers in Bioinformatics May 3rd, 2010 m m 1 2 3 m m Introduction m Definition is a method of solving problems by breaking them down into simpler steps problem need to contain overlapping

More information

OPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT

OPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT OPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT Asif Ali Khan*, Laiq Hassan*, Salim Ullah* ABSTRACT: In bioinformatics, sequence alignment is a common and insistent task. Biologists align

More information

Sequence comparison: Local alignment

Sequence comparison: Local alignment Sequence comparison: Local alignment Genome 559: Introuction to Statistical an Computational Genomics Prof. James H. Thomas http://faculty.washington.eu/jht/gs559_217/ Review global alignment en traceback

More information

Notes on Dynamic-Programming Sequence Alignment

Notes on Dynamic-Programming Sequence Alignment Notes on Dynamic-Programming Sequence Alignment Introduction. Following its introduction by Needleman and Wunsch (1970), dynamic programming has become the method of choice for rigorous alignment of DNA

More information

Dynamic Programming Part I: Examples. Bioinfo I (Institut Pasteur de Montevideo) Dynamic Programming -class4- July 25th, / 77

Dynamic Programming Part I: Examples. Bioinfo I (Institut Pasteur de Montevideo) Dynamic Programming -class4- July 25th, / 77 Dynamic Programming Part I: Examples Bioinfo I (Institut Pasteur de Montevideo) Dynamic Programming -class4- July 25th, 2011 1 / 77 Dynamic Programming Recall: the Change Problem Other problems: Manhattan

More information

BLAST. NCBI BLAST Basic Local Alignment Search Tool

BLAST. NCBI BLAST Basic Local Alignment Search Tool BLAST NCBI BLAST Basic Local Alignment Search Tool http://www.ncbi.nlm.nih.gov/blast/ Global versus local alignments Global alignments: Attempt to align every residue in every sequence, Most useful when

More information

Salvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón

Salvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón trimal: a tool for automated alignment trimming in large-scale phylogenetics analyses Salvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón Version 1.2b Index of contents 1. General features

More information

Lecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:

Lecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations: Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating

More information

Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.

Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the

More information

Sequence Alignment & Search

Sequence Alignment & Search Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version

More information

Algorithmic Approaches for Biological Data, Lecture #20

Algorithmic Approaches for Biological Data, Lecture #20 Algorithmic Approaches for Biological Data, Lecture #20 Katherine St. John City University of New York American Museum of Natural History 20 April 2016 Outline Aligning with Gaps and Substitution Matrices

More information

From Smith-Waterman to BLAST

From Smith-Waterman to BLAST From Smith-Waterman to BLAST Jeremy Buhler July 23, 2015 Smith-Waterman is the fundamental tool that we use to decide how similar two sequences are. Isn t that all that BLAST does? In principle, it is

More information

Local Alignment & Gap Penalties CMSC 423

Local Alignment & Gap Penalties CMSC 423 Local Alignment & ap Penalties CMSC 423 lobal, Semi-global, Local Alignments Last time, we saw a dynamic programming algorithm for global alignment: both strings s and t must be completely matched: s t

More information

In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace.

In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace. 5 Multiple Match Refinement and T-Coffee In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace. This exposition

More information

Today s Lecture. Edit graph & alignment algorithms. Local vs global Computational complexity of pairwise alignment Multiple sequence alignment

Today s Lecture. Edit graph & alignment algorithms. Local vs global Computational complexity of pairwise alignment Multiple sequence alignment Today s Lecture Edit graph & alignment algorithms Smith-Waterman algorithm Needleman-Wunsch algorithm Local vs global Computational complexity of pairwise alignment Multiple sequence alignment 1 Sequence

More information

AlignMe Manual. Version 1.1. Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest

AlignMe Manual. Version 1.1. Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest AlignMe Manual Version 1.1 Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest Max Planck Institute of Biophysics Frankfurt am Main 60438 Germany 1) Introduction...3 2) Using AlignMe

More information

Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD

Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Assumptions: Biological sequences evolved by evolution. Micro scale changes: For short sequences (e.g. one

More information

FASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm.

FASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm. FASTA INTRODUCTION Definition (by David J. Lipman and William R. Pearson in 1985) - Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence

More information

COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1. Database Searching

COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1. Database Searching COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1 Database Searching In database search, we typically have a large sequence database

More information

A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity

A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity G. Pratyusha, Department of Computer Science & Engineering, V.R.Siddhartha Engineering College(Autonomous)

More information

Sequence alignment algorithms

Sequence alignment algorithms Sequence alignment algorithms Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 23 rd 27 After this lecture, you can decide when to use local and global sequence alignments

More information

Computational Molecular Biology

Computational Molecular Biology Computational Molecular Biology Erwin M. Bakker Lecture 3, mainly from material by R. Shamir [2] and H.J. Hoogeboom [4]. 1 Pairwise Sequence Alignment Biological Motivation Algorithmic Aspect Recursive

More information

Lecture 3: February Local Alignment: The Smith-Waterman Algorithm

Lecture 3: February Local Alignment: The Smith-Waterman Algorithm CSCI1820: Sequence Alignment Spring 2017 Lecture 3: February 7 Lecturer: Sorin Istrail Scribe: Pranavan Chanthrakumar Note: LaTeX template courtesy of UC Berkeley EECS dept. Notes are also adapted from

More information

Introduction to BLAST with Protein Sequences. Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2

Introduction to BLAST with Protein Sequences. Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2 Introduction to BLAST with Protein Sequences Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2 1 References Chapter 2 of Biological Sequence Analysis (Durbin et al., 2001)

More information

Computational Biology Lecture 4: Overlap detection, Local Alignment, Space Efficient Needleman-Wunsch Saad Mneimneh

Computational Biology Lecture 4: Overlap detection, Local Alignment, Space Efficient Needleman-Wunsch Saad Mneimneh Computational Biology Lecture 4: Overlap detection, Local Alignment, Space Efficient Needleman-Wunsch Saad Mneimneh Overlap detection: Semi-Global Alignment An overlap of two sequences is considered an

More information

Computational Genomics and Molecular Biology, Fall

Computational Genomics and Molecular Biology, Fall Computational Genomics and Molecular Biology, Fall 2015 1 Sequence Alignment Dannie Durand Pairwise Sequence Alignment The goal of pairwise sequence alignment is to establish a correspondence between the

More information

BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha

BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio. 1990. CS 466 Saurabh Sinha Motivation Sequence homology to a known protein suggest function of newly sequenced protein Bioinformatics

More information

CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment

CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features

More information

TCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology?

TCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology? Local Sequence Alignment & Heuristic Local Aligners Lectures 18 Nov 28, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall

More information

Bioinformatics for Biologists

Bioinformatics for Biologists Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover

More information

Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion.

Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. www.ijarcet.org 54 Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. Hassan Kehinde Bello and Kazeem Alagbe Gbolagade Abstract Biological sequence alignment is becoming popular

More information

Pairwise Sequence Alignment. Zhongming Zhao, PhD

Pairwise Sequence Alignment. Zhongming Zhao, PhD Pairwise Sequence Alignment Zhongming Zhao, PhD Email: zhongming.zhao@vanderbilt.edu http://bioinfo.mc.vanderbilt.edu/ Sequence Similarity match mismatch A T T A C G C G T A C C A T A T T A T G C G A T

More information

Biochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA)

Biochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA) Biochemistry 324 Bioinformatics Multiple Sequence Alignment (MSA) Big- Οh notation Greek omicron symbol Ο The Big-Oh notation indicates the complexity of an algorithm in terms of execution speed and storage

More information

Distributed Protein Sequence Alignment

Distributed Protein Sequence Alignment Distributed Protein Sequence Alignment ABSTRACT J. Michael Meehan meehan@wwu.edu James Hearne hearne@wwu.edu Given the explosive growth of biological sequence databases and the computational complexity

More information

A Design of a Hybrid System for DNA Sequence Alignment

A Design of a Hybrid System for DNA Sequence Alignment IMECS 2008, 9-2 March, 2008, Hong Kong A Design of a Hybrid System for DNA Sequence Alignment Heba Khaled, Hossam M. Faheem, Tayseer Hasan, Saeed Ghoneimy Abstract This paper describes a parallel algorithm

More information

BLAST MCDB 187. Friday, February 8, 13

BLAST MCDB 187. Friday, February 8, 13 BLAST MCDB 187 BLAST Basic Local Alignment Sequence Tool Uses shortcut to compute alignments of a sequence against a database very quickly Typically takes about a minute to align a sequence against a database

More information

Opinionated. Lessons. #52 Dynamic Programming. in Statistics. by Bill Press

Opinionated. Lessons. #52 Dynamic Programming. in Statistics. by Bill Press Opinionated Lessons in Statistics by Bill Press #52 Dynamic Programming Professor William H. Press, Department of Computer Science, the University of Texas at Austin 1 Dynamic Programming Shortest path

More information

CHAPTER-6 WEB USAGE MINING USING CLUSTERING

CHAPTER-6 WEB USAGE MINING USING CLUSTERING CHAPTER-6 WEB USAGE MINING USING CLUSTERING 6.1 Related work in Clustering Technique 6.2 Quantifiable Analysis of Distance Measurement Techniques 6.3 Approaches to Formation of Clusters 6.4 Conclusion

More information

BLAST & Genome assembly

BLAST & Genome assembly BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies May 15, 2014 1 BLAST What is BLAST? The algorithm 2 Genome assembly De novo assembly Mapping assembly 3

More information

Basic Local Alignment Search Tool (BLAST)

Basic Local Alignment Search Tool (BLAST) BLAST 26.04.2018 Basic Local Alignment Search Tool (BLAST) BLAST (Altshul-1990) is an heuristic Pairwise Alignment composed by six-steps that search for local similarities. The most used access point to

More information

A CAM(Content Addressable Memory)-based architecture for molecular sequence matching

A CAM(Content Addressable Memory)-based architecture for molecular sequence matching A CAM(Content Addressable Memory)-based architecture for molecular sequence matching P.K. Lala 1 and J.P. Parkerson 2 1 Department Electrical Engineering, Texas A&M University, Texarkana, Texas, USA 2

More information

Brief review from last class

Brief review from last class Sequence Alignment Brief review from last class DNA is has direction, we will use only one (5 -> 3 ) and generate the opposite strand as needed. DNA is a 3D object (see lecture 1) but we will model it

More information

DNA Alignment With Affine Gap Penalties

DNA Alignment With Affine Gap Penalties DNA Alignment With Affine Gap Penalties Laurel Schuster Why Use Affine Gap Penalties? When aligning two DNA sequences, one goal may be to infer the mutations that made them different. Though it s impossible

More information

Algorithms in Bioinformatics: A Practical Introduction. Database Search

Algorithms in Bioinformatics: A Practical Introduction. Database Search Algorithms in Bioinformatics: A Practical Introduction Database Search Biological databases Biological data is double in size every 15 or 16 months Increasing in number of queries: 40,000 queries per day

More information

CISC 636 Computational Biology & Bioinformatics (Fall 2016)

CISC 636 Computational Biology & Bioinformatics (Fall 2016) CISC 636 Computational Biology & Bioinformatics (Fall 2016) Sequence pairwise alignment Score statistics: E-value and p-value Heuristic algorithms: BLAST and FASTA Database search: gene finding and annotations

More information

Chapter 6. Multiple sequence alignment (week 10)

Chapter 6. Multiple sequence alignment (week 10) Course organization Introduction ( Week 1,2) Part I: Algorithms for Sequence Analysis (Week 1-11) Chapter 1-3, Models and theories» Probability theory and Statistics (Week 3)» Algorithm complexity analysis

More information

Keywords -Bioinformatics, sequence alignment, Smith- waterman (SW) algorithm, GPU, CUDA

Keywords -Bioinformatics, sequence alignment, Smith- waterman (SW) algorithm, GPU, CUDA Volume 5, Issue 5, May 2015 ISSN: 2277 128X International Journal of Advanced Research in Computer Science and Software Engineering Research Paper Available online at: www.ijarcsse.com Accelerating Smith-Waterman

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 04: Variations of sequence alignments http://www.pitt.edu/~mcs2/teaching/biocomp/tutorials/global.html Slides adapted from Dr. Shaojie Zhang (University

More information

Reconstructing long sequences from overlapping sequence fragment. Searching databases for related sequences and subsequences

Reconstructing long sequences from overlapping sequence fragment. Searching databases for related sequences and subsequences SEQUENCE ALIGNMENT ALGORITHMS 1 Why compare sequences? Reconstructing long sequences from overlapping sequence fragment Searching databases for related sequences and subsequences Storing, retrieving and

More information

Lectures 12 and 13 Dynamic programming: weighted interval scheduling

Lectures 12 and 13 Dynamic programming: weighted interval scheduling Lectures 12 and 13 Dynamic programming: weighted interval scheduling COMP 523: Advanced Algorithmic Techniques Lecturer: Dariusz Kowalski Lectures 12-13: Dynamic Programming 1 Overview Last week: Graph

More information

Profiles and Multiple Alignments. COMP 571 Luay Nakhleh, Rice University

Profiles and Multiple Alignments. COMP 571 Luay Nakhleh, Rice University Profiles and Multiple Alignments COMP 571 Luay Nakhleh, Rice University Outline Profiles and sequence logos Profile hidden Markov models Aligning profiles Multiple sequence alignment by gradual sequence

More information

1 Dynamic Programming

1 Dynamic Programming Recitation 13 Dynamic Programming Parallel and Sequential Data Structures and Algorithms, 15-210 (Fall 2013) November 20, 2013 1 Dynamic Programming Dynamic programming is a technique to avoid needless

More information

CPSC 340: Machine Learning and Data Mining

CPSC 340: Machine Learning and Data Mining CPSC 340: Machine Learning and Data Mining Feature Selection Original version of these slides by Mark Schmidt, with modifications by Mike Gelbart. Admin Assignment 3: Due Friday Midterm: Feb 14 in class

More information

Indexing and Searching

Indexing and Searching Indexing and Searching Introduction How to retrieval information? A simple alternative is to search the whole text sequentially Another option is to build data structures over the text (called indices)

More information

Mouse, Human, Chimpanzee

Mouse, Human, Chimpanzee More Alignments 1 Mouse, Human, Chimpanzee Mouse to Human Chimpanzee to Human 2 Mouse v.s. Human Chromosome X of Mouse to Human 3 Local Alignment Given: two sequences S and T Find: substrings of S and

More information

BMI/CS 576 Fall 2015 Midterm Exam

BMI/CS 576 Fall 2015 Midterm Exam BMI/CS 576 Fall 2015 Midterm Exam Prof. Colin Dewey Tuesday, October 27th, 2015 11:00am-12:15pm Name: KEY Write your answers on these pages and show your work. You may use the back sides of pages as necessary.

More information

Alignment ABC. Most slides are modified from Serafim s lectures

Alignment ABC. Most slides are modified from Serafim s lectures Alignment ABC Most slides are modified from Serafim s lectures Complete genomes Evolution Evolution at the DNA level C ACGGTGCAGTCACCA ACGTTGCAGTCCACCA SEQUENCE EDITS REARRANGEMENTS Sequence conservation

More information

Lecture 10: Local Alignments

Lecture 10: Local Alignments Lecture 10: Local Alignments Study Chapter 6.8-6.10 1 Outline Edit Distances Longest Common Subsequence Global Sequence Alignment Scoring Matrices Local Sequence Alignment Alignment with Affine Gap Penalties

More information

24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:

24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading: 24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid

More information

BLAST. Basic Local Alignment Search Tool. Used to quickly compare a protein or DNA sequence to a database.

BLAST. Basic Local Alignment Search Tool. Used to quickly compare a protein or DNA sequence to a database. BLAST Basic Local Alignment Search Tool Used to quickly compare a protein or DNA sequence to a database. There is no such thing as a free lunch BLAST is fast and highly sensitive compared to competitors.

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 06: Multiple Sequence Alignment https://upload.wikimedia.org/wikipedia/commons/thumb/7/79/rplp0_90_clustalw_aln.gif/575px-rplp0_90_clustalw_aln.gif Slides

More information

SWAMP: Smith-Waterman using Associative Massive Parallelism

SWAMP: Smith-Waterman using Associative Massive Parallelism SWAMP: Smith-Waterman using Associative Massive Parallelism Shannon Steinfadt Dr. Johnnie W. Baker Department of Computer Science, Kent State University, Kent, Ohio 44242 USA ssteinfa@cs.kent.edu jbaker@cs.kent.edu

More information

Chapter 8 Multiple sequence alignment. Chaochun Wei Spring 2018

Chapter 8 Multiple sequence alignment. Chaochun Wei Spring 2018 1896 1920 1987 2006 Chapter 8 Multiple sequence alignment Chaochun Wei Spring 2018 Contents 1. Reading materials 2. Multiple sequence alignment basic algorithms and tools how to improve multiple alignment

More information

Lesson 2 7 Graph Partitioning

Lesson 2 7 Graph Partitioning Lesson 2 7 Graph Partitioning The Graph Partitioning Problem Look at the problem from a different angle: Let s multiply a sparse matrix A by a vector X. Recall the duality between matrices and graphs:

More information

Sequence Alignment (chapter 6) p The biological problem p Global alignment p Local alignment p Multiple alignment

Sequence Alignment (chapter 6) p The biological problem p Global alignment p Local alignment p Multiple alignment Sequence lignment (chapter 6) p The biological problem p lobal alignment p Local alignment p Multiple alignment Local alignment: rationale p Otherwise dissimilar proteins may have local regions of similarity

More information

Hardware Accelerator for Biological Sequence Alignment using Coreworks Processing Engine

Hardware Accelerator for Biological Sequence Alignment using Coreworks Processing Engine Hardware Accelerator for Biological Sequence Alignment using Coreworks Processing Engine José Cabrita, Gilberto Rodrigues, Paulo Flores INESC-ID / IST, Technical University of Lisbon jpmcabrita@gmail.com,

More information

Today s Lecture. Multiple sequence alignment. Improved scoring of pairwise alignments. Affine gap penalties Profiles

Today s Lecture. Multiple sequence alignment. Improved scoring of pairwise alignments. Affine gap penalties Profiles Today s Lecture Multiple sequence alignment Improved scoring of pairwise alignments Affine gap penalties Profiles 1 The Edit Graph for a Pair of Sequences G A C G T T G A A T G A C C C A C A T G A C G

More information

.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar..

.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. .. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. PAM and BLOSUM Matrices Prepared by: Jason Banich and Chris Hoover Background As DNA sequences change and evolve, certain amino acids are more

More information

Pairwise Sequence alignment Basic Algorithms

Pairwise Sequence alignment Basic Algorithms Pairwise Sequence alignment Basic Algorithms Agenda - Previous Lesson: Minhala - + Biological Story on Biomolecular Sequences - + General Overview of Problems in Computational Biology - Reminder: Dynamic

More information

Lecture 5: Multiple sequence alignment

Lecture 5: Multiple sequence alignment Lecture 5: Multiple sequence alignment Introduction to Computational Biology Teresa Przytycka, PhD (with some additions by Martin Vingron) Why do we need multiple sequence alignment Pairwise sequence alignment

More information

BLAST, Profile, and PSI-BLAST

BLAST, Profile, and PSI-BLAST BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources

More information

BLAST & Genome assembly

BLAST & Genome assembly BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies November 17, 2012 1 Introduction Introduction 2 BLAST What is BLAST? The algorithm 3 Genome assembly De

More information

Alignment of Long Sequences

Alignment of Long Sequences Alignment of Long Sequences BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2009 Mark Craven craven@biostat.wisc.edu Pairwise Whole Genome Alignment: Task Definition Given a pair of genomes (or other large-scale

More information

BGGN 213 Foundations of Bioinformatics Barry Grant

BGGN 213 Foundations of Bioinformatics Barry Grant BGGN 213 Foundations of Bioinformatics Barry Grant http://thegrantlab.org/bggn213 Recap From Last Time: 25 Responses: https://tinyurl.com/bggn213-02-f17 Why ALIGNMENT FOUNDATIONS Why compare biological

More information

A Hybrid Heuristic/Deterministic Dynamic Programing Technique for Fast Sequence Alignment

A Hybrid Heuristic/Deterministic Dynamic Programing Technique for Fast Sequence Alignment Vol 6, No 8, 25 A Hybrid Heuristic/Deterministic Dynamic Programing Technique for Fast Sequence Alignment Talal Bonny Department of Electrical and Computer Engineering College of Engineering University

More information

Centralities (4) By: Ralucca Gera, NPS. Excellence Through Knowledge

Centralities (4) By: Ralucca Gera, NPS. Excellence Through Knowledge Centralities (4) By: Ralucca Gera, NPS Excellence Through Knowledge Some slide from last week that we didn t talk about in class: 2 PageRank algorithm Eigenvector centrality: i s Rank score is the sum

More information

The Effect of Inverse Document Frequency Weights on Indexed Sequence Retrieval. Kevin C. O'Kane. Department of Computer Science

The Effect of Inverse Document Frequency Weights on Indexed Sequence Retrieval. Kevin C. O'Kane. Department of Computer Science The Effect of Inverse Document Frequency Weights on Indexed Sequence Retrieval Kevin C. O'Kane Department of Computer Science The University of Northern Iowa Cedar Falls, Iowa okane@cs.uni.edu http://www.cs.uni.edu/~okane

More information

Modified Distribution Method

Modified Distribution Method istributors C 8 Step : Make an initial allocation with the North-West corner rule. KPP istributors C 8 V j Step : Make an initial allocation with the North-West corner rule. Step : Introduce the variables,

More information

Similarity Searches on Sequence Databases

Similarity Searches on Sequence Databases Similarity Searches on Sequence Databases Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Zürich, October 2004 Swiss Institute of Bioinformatics Swiss EMBnet node Outline Importance of

More information

Research Article International Journals of Advanced Research in Computer Science and Software Engineering ISSN: X (Volume-7, Issue-6)

Research Article International Journals of Advanced Research in Computer Science and Software Engineering ISSN: X (Volume-7, Issue-6) International Journals of Advanced Research in Computer Science and Software Engineering ISSN: 77-18X (Volume-7, Issue-6) Research Article June 017 DDGARM: Dotlet Driven Global Alignment with Reduced Matrix

More information

EECS 4425: Introductory Computational Bioinformatics Fall Suprakash Datta

EECS 4425: Introductory Computational Bioinformatics Fall Suprakash Datta EECS 4425: Introductory Computational Bioinformatics Fall 2018 Suprakash Datta datta [at] cse.yorku.ca Office: CSEB 3043 Phone: 416-736-2100 ext 77875 Course page: http://www.cse.yorku.ca/course/4425 Many

More information

Pairwise alignment II

Pairwise alignment II Pairwise alignment II Agenda - Previous Lesson: Minhala + Introduction - Review Dynamic Programming - Pariwise Alignment Biological Motivation Today: - Quick Review: Sequence Alignment (Global, Local,

More information

Multiple Sequence Alignment. Mark Whitsitt - NCSA

Multiple Sequence Alignment. Mark Whitsitt - NCSA Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV

More information

Alignment and clustering tools for sequence analysis. Omar Abudayyeh Presentation December 9, 2015

Alignment and clustering tools for sequence analysis. Omar Abudayyeh Presentation December 9, 2015 Alignment and clustering tools for sequence analysis Omar Abudayyeh 18.337 Presentation December 9, 2015 Introduction Sequence comparison is critical for inferring biological relationships within large

More information

GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment

GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment Scoring Dynamic Programming algorithms Heuristic algorithms CLUSTAL W Courtesy of jalview Motivations Collective (or aggregate) statistic

More information

Darwin-WGA. A Co-processor Provides Increased Sensitivity in Whole Genome Alignments with High Speedup

Darwin-WGA. A Co-processor Provides Increased Sensitivity in Whole Genome Alignments with High Speedup Darwin-WGA A Co-processor Provides Increased Sensitivity in Whole Genome Alignments with High Speedup Yatish Turakhia*, Sneha D. Goenka*, Prof. Gill Bejerano, Prof. William J. Dally * Equal contribution

More information

Acceleration of the Smith-Waterman algorithm for DNA sequence alignment using an FPGA platform

Acceleration of the Smith-Waterman algorithm for DNA sequence alignment using an FPGA platform Acceleration of the Smith-Waterman algorithm for DNA sequence alignment using an FPGA platform Barry Strengholt Matthijs Brobbel Delft University of Technology Faculty of Electrical Engineering, Mathematics

More information