Sequence Alignment. part 2
|
|
- Monica Moore
- 5 years ago
- Views:
Transcription
1 Sequence Alignment part 2
2 Dynamic programming with more realistic scoring scheme Using the same initial sequences, we ll look at a dynamic programming example with a scoring scheme that selects for matches and penalizes both mismatched and gaps, as follows: S i,j = 2 if residues match S i,j = -1 if there is a mismatch at the current position w = -2 (gap penalty)
3 Initialization same as before Example sequences: GAATTCAGTTA (sequence 1: M=11) GGATCGA (sequence 2: N=7) G 0 G 0 A 0 T 0 C 0 G 0 A 0 G A A T T C A G T T A
4 Filling matrix (scoring) Recall the scoring scheme: M i,j (matrix position to be filled in) = maximum of these 3 terms: M i-1, j-1 + S i,j (match/mismatch in diagonal) where: o S i,j = 2 for match o S i,j = -1 for mismatch M i, j-1 + w (gap in sequence 1) M i-1,j + w (gap in sequence 2) in either case, w = -2
5 Filling matrix (scoring) Since both sequences start with G, the maximum value for M 1,1 is = 2 for the match G A A T T C A G T T A G 0 2 G 0 A 0 T 0 C 0 G 0 A 0
6 Filling matrix (scoring) Continuing down column 2, we see that the G in the first position of sequence 1 also matches the G in the second position of sequence 2; this means that M1,2 will be the maximum of [2, -2, -2] which is 2 We also add a backward pointing arrow at each position to show where the maximum score came from (see next slide)
7 Filling matrix (scoring) G A A T T C A G T T A G 0 2 G 0 2 A 0 T 0 C 0 G 0 A 0
8 Filling matrix (scoring) At M 1,3 there is no match, so S 1,3 = -1 M 1,3 = MAX[M 0,2-1, M 1,2-2,M 0,3-2] = MAX[-1,0,-2] = 0 G A A T T C A G T T A G 0 2 G 0 2 A 0 0 T 0 C 0 G 0 A 0
9 Filling matrix (scoring) We can continue filling in column 1 using the same reasoning: G A A T T C A G T T A G 0 2 G 0 2 A 0 0 T 0-1 C 0-1 G 0 2 A 0 0
10 Filling matrix (scoring) We continue into column 2: G A A T T C A G T T A G G A T C G A 0 0 4
11 Filling matrix (scoring) At column 3 row 3 we encounter the following situation: M 3,2 = MAX[M 2,1-1, M 3,1-2,M 2,2-2] = MAX[-1,-3,-1] = -1 Since there are 2 different ways we could reach the maximum score, we provide arrows back to both cells that could get us there: G A A T T C A G T T A G G A T C G A 0 0 4
12 Completed matrix G A A T T C A G T T A G G A T C G A
13 Traceback Maximum global alignment is 3, the value in the last row of the last column; traceback step begins here The traceback step is simplified by the presence of the arrows we can follow them to get to the predecessor at each step Since some locations have multiple arrows, we may find multiple alignments, but there will be fewer than under the simple scoring scheme we used before
14 Second possible path Alternate path gives the following alignment: GAATTCAGTTA GGAT-C-G--A
15 Verifying the score(s) Recall our scoring scheme: match: +2 mismatch: -1 gap: -2 Final overall score in table was 3, so alignments should add up to 3, given the above Calculations on next slide verify that they do
16 Verifying the score(s) First alignment: GAATTCAGTTA GGA-TC-G--A = 3 Second alignment: GAATTCAGTTA GGAT-C-G--A = 3
17 Global alignments: pros & cons What they re good for: checking for minor differences between sequences comparing sequences that partly overlap What they re not good for: discovering similarities between 2 sequences exploring similarities within a family of sequences (for this we do multiple alignment)
18 Programming global alignment GA algorithms are based on dynamic programming which is a recursive technique Recursion can be summarized as follows: nature of the problem: must be divisible into smaller subproblems begin by solving the smallest subproblems solutions to smallest problems are used in solutions to larger problems process continues until entire (largest) problem is solved
19 Detailed algorithm: step 1: build scoring matrix 1. Read in 2 sequences to be aligned: lines 7-25 of program 2. Obtain match, mismatch & gap scores (from user): lines Create m+1 x n+1 matrix (see next slide): lines Prepend a blank character to the front of both sequences (so that position 0 of each sequence contains a blank, and sequence indices are consistent with matrix indices): lines 30 & 31
20 Arrays in Perl Array: single variable that holds multiple scalar values individual elements are accessible via index (subscript) one-dimensional array: vector two-dimensional array: matrix
21 Array declaration & notation To distinguish a vector or matrix from a scalar, the starting character of the array = (); # declares empty array We refer to the entire array we reference individual elements using $name and subscript(s): for ($i=0; $i<10; $i++) { $array[$i] = ; } # initializes 10-element vector to blank strings
22 Example program #!/usr/bin/perl # declare = (); # initialize with empty strings: for ($i=0; $i<10; $i++) { $array[$i]=''; } # print it all out backwards: for ($i=9; $i>=0; $i--) { print $array[$i]. "\n"; } # prompt for & read in some data: for ($i=0; $i<10; $i++) { print "Please enter a word or phrase:\n"; $array[$i] = <STDIN>; }
23 Back to algorithm 5. Initialize first row & first column of matrix by adding gap penalty to each successive cell: lines Fill remaining cells (lines 66-99): compute three candidate values for each cell by adding gap penalty or match score (as appropriate) to value in appropriate neighboring cell (lines 80-87) compare the three values to determine maximum score (lines 89-97)
24 Algorithm continued 7. Develop directional string to facilitate traceback: lines unlike the human observer, a program cannot see directional arrows in the matrix instead, we create a string containing directional indicators to develop a traceback path: H indicates left neighbor (horizontal gap) D indicates diagonal neighbor (match/mismatch) V indicates above neighbor (vertical gap)
25 Algorithm continued Perform traceback (lines ): Starting at the right end of each sequence, obtain the current character Read the first (leftmost) character of the directional string & align the retrieved sequence characters as directed Continue until you run out of directional characters
26 Terminal gaps & semiglobal alignments Terminal gaps occur when you align 2 sequences that differ significantly in length; our global alignment algorithm doesn t distinguish between these gaps and internal gaps, even though an alignment with only terminal gaps actually represents the optimal alignment For example, the three alignments below represent what the global alignment would consider optimal: CGCTATAG CGCTATAG CGCTATAG --CTA--- C--TA--- --C--TA- Eliminating the gap penalty for terminal gaps produces a semiglobal alignment
27 Local alignment Many pairs of sequences will include regions of high similarity (conserved regions) interspersed with dissimilar regions A global alignment algorithm on such sequences will result in poor scores and/or many equally (un)likely alignments reported as optimal In such situations, a local alignment algorithm is preferable
28 Local alignment Uses for local alignment: compare distantly-related sequences that share a few non-connected regions in common analysis of repeated elements within a single sequence Smith-Waterman: the original local alignment algorithm
29 Smith-Waterman algorithm Uses scoring system similar to Needleman-Wunsch for building matrix: M i,j = maximum of: 0 or M i-1, j-1 + S i,j or M i-1, j + w or M i, j Note that the inclusion of 0 as a possible maximum eliminates negative values from the matrix FASTA format originated with FASTA algorithm a fast (or fasta ) approximation of Smith-Waterman
30 Online resource for local alignment BLAST: bl2seq Lalign: slower but more accurate than BLAST BLAST returns only best alignment between query & target Lalign returns as many as specified, ranked from best to worst
31 Lalign output % identity within conserved regions length of alignment score: sum of gap/substitution penalties higher score = better alignment E-value better indicator of alignment quality lower = better
32 A look under the hood at BLAST BLAST algorithm splits query sequence into hot spots consisting of: words : short subsequences neighboring words : subsequences similar to words Sequence database is scanned for matches to these hot spots Identified matches used to extend hot spots Uses heuristics to identify best matches
33 BLAST algorithm illustrated
An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST
An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise
More informationLecture 10. Sequence alignments
Lecture 10 Sequence alignments Alignment algorithms: Overview Given a scoring system, we need to have an algorithm for finding an optimal alignment for a pair of sequences. We want to maximize the score
More informationPairwise Sequence Alignment: Dynamic Programming Algorithms. COMP Spring 2015 Luay Nakhleh, Rice University
Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 - Spring 2015 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment The number of all possible pairwise alignments (if
More informationDynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014
Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into
More informationSequence analysis Pairwise sequence alignment
UMF11 Introduction to bioinformatics, 25 Sequence analysis Pairwise sequence alignment 1. Sequence alignment Lecturer: Marina lexandersson 12 September, 25 here are two types of sequence alignments, global
More informationPairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University
1 Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment 2 The number of all possible pairwise alignments (if gaps are allowed)
More informationSequence Comparison: Dynamic Programming. Genome 373 Genomic Informatics Elhanan Borenstein
Sequence omparison: Dynamic Programming Genome 373 Genomic Informatics Elhanan Borenstein quick review: hallenges Find the best global alignment of two sequences Find the best global alignment of multiple
More informationBiology 644: Bioinformatics
Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find
More informationSequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it.
Sequence Alignments Overview Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it. Sequence alignment means arranging
More informationRochester Institute of Technology. Making personalized education scalable using Sequence Alignment Algorithm
Rochester Institute of Technology Making personalized education scalable using Sequence Alignment Algorithm Submitted by: Lakhan Bhojwani Advisor: Dr. Carlos Rivero 1 1. Abstract There are many ways proposed
More informationBIOL591: Introduction to Bioinformatics Alignment of pairs of sequences
BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences Reading in text (Mount Bioinformatics): I must confess that the treatment in Mount of sequence alignment does not seem to me a model
More informationProgramming assignment for the course Sequence Analysis (2006)
Programming assignment for the course Sequence Analysis (2006) Original text by John W. Romein, adapted by Bart van Houte (bart@cs.vu.nl) Introduction Please note: This assignment is only obligatory for
More informationBioinformatics explained: Smith-Waterman
Bioinformatics Explained Bioinformatics explained: Smith-Waterman May 1, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com
More informationDynamic Programming & Smith-Waterman algorithm
m m Seminar: Classical Papers in Bioinformatics May 3rd, 2010 m m 1 2 3 m m Introduction m Definition is a method of solving problems by breaking them down into simpler steps problem need to contain overlapping
More informationOPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT
OPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT Asif Ali Khan*, Laiq Hassan*, Salim Ullah* ABSTRACT: In bioinformatics, sequence alignment is a common and insistent task. Biologists align
More informationSequence comparison: Local alignment
Sequence comparison: Local alignment Genome 559: Introuction to Statistical an Computational Genomics Prof. James H. Thomas http://faculty.washington.eu/jht/gs559_217/ Review global alignment en traceback
More informationNotes on Dynamic-Programming Sequence Alignment
Notes on Dynamic-Programming Sequence Alignment Introduction. Following its introduction by Needleman and Wunsch (1970), dynamic programming has become the method of choice for rigorous alignment of DNA
More informationDynamic Programming Part I: Examples. Bioinfo I (Institut Pasteur de Montevideo) Dynamic Programming -class4- July 25th, / 77
Dynamic Programming Part I: Examples Bioinfo I (Institut Pasteur de Montevideo) Dynamic Programming -class4- July 25th, 2011 1 / 77 Dynamic Programming Recall: the Change Problem Other problems: Manhattan
More informationBLAST. NCBI BLAST Basic Local Alignment Search Tool
BLAST NCBI BLAST Basic Local Alignment Search Tool http://www.ncbi.nlm.nih.gov/blast/ Global versus local alignments Global alignments: Attempt to align every residue in every sequence, Most useful when
More informationSalvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón
trimal: a tool for automated alignment trimming in large-scale phylogenetics analyses Salvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón Version 1.2b Index of contents 1. General features
More informationLecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:
Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating
More informationCompares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.
Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the
More informationSequence Alignment & Search
Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version
More informationAlgorithmic Approaches for Biological Data, Lecture #20
Algorithmic Approaches for Biological Data, Lecture #20 Katherine St. John City University of New York American Museum of Natural History 20 April 2016 Outline Aligning with Gaps and Substitution Matrices
More informationFrom Smith-Waterman to BLAST
From Smith-Waterman to BLAST Jeremy Buhler July 23, 2015 Smith-Waterman is the fundamental tool that we use to decide how similar two sequences are. Isn t that all that BLAST does? In principle, it is
More informationLocal Alignment & Gap Penalties CMSC 423
Local Alignment & ap Penalties CMSC 423 lobal, Semi-global, Local Alignments Last time, we saw a dynamic programming algorithm for global alignment: both strings s and t must be completely matched: s t
More informationIn this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace.
5 Multiple Match Refinement and T-Coffee In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace. This exposition
More informationToday s Lecture. Edit graph & alignment algorithms. Local vs global Computational complexity of pairwise alignment Multiple sequence alignment
Today s Lecture Edit graph & alignment algorithms Smith-Waterman algorithm Needleman-Wunsch algorithm Local vs global Computational complexity of pairwise alignment Multiple sequence alignment 1 Sequence
More informationAlignMe Manual. Version 1.1. Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest
AlignMe Manual Version 1.1 Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest Max Planck Institute of Biophysics Frankfurt am Main 60438 Germany 1) Introduction...3 2) Using AlignMe
More informationLecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD
Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Assumptions: Biological sequences evolved by evolution. Micro scale changes: For short sequences (e.g. one
More informationFASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm.
FASTA INTRODUCTION Definition (by David J. Lipman and William R. Pearson in 1985) - Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence
More informationCOS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1. Database Searching
COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1 Database Searching In database search, we typically have a large sequence database
More informationA Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity
A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity G. Pratyusha, Department of Computer Science & Engineering, V.R.Siddhartha Engineering College(Autonomous)
More informationSequence alignment algorithms
Sequence alignment algorithms Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 23 rd 27 After this lecture, you can decide when to use local and global sequence alignments
More informationComputational Molecular Biology
Computational Molecular Biology Erwin M. Bakker Lecture 3, mainly from material by R. Shamir [2] and H.J. Hoogeboom [4]. 1 Pairwise Sequence Alignment Biological Motivation Algorithmic Aspect Recursive
More informationLecture 3: February Local Alignment: The Smith-Waterman Algorithm
CSCI1820: Sequence Alignment Spring 2017 Lecture 3: February 7 Lecturer: Sorin Istrail Scribe: Pranavan Chanthrakumar Note: LaTeX template courtesy of UC Berkeley EECS dept. Notes are also adapted from
More informationIntroduction to BLAST with Protein Sequences. Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2
Introduction to BLAST with Protein Sequences Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2 1 References Chapter 2 of Biological Sequence Analysis (Durbin et al., 2001)
More informationComputational Biology Lecture 4: Overlap detection, Local Alignment, Space Efficient Needleman-Wunsch Saad Mneimneh
Computational Biology Lecture 4: Overlap detection, Local Alignment, Space Efficient Needleman-Wunsch Saad Mneimneh Overlap detection: Semi-Global Alignment An overlap of two sequences is considered an
More informationComputational Genomics and Molecular Biology, Fall
Computational Genomics and Molecular Biology, Fall 2015 1 Sequence Alignment Dannie Durand Pairwise Sequence Alignment The goal of pairwise sequence alignment is to establish a correspondence between the
More informationBLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha
BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio. 1990. CS 466 Saurabh Sinha Motivation Sequence homology to a known protein suggest function of newly sequenced protein Bioinformatics
More informationCISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment
CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features
More informationTCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology?
Local Sequence Alignment & Heuristic Local Aligners Lectures 18 Nov 28, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall
More informationBioinformatics for Biologists
Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover
More informationAcceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion.
www.ijarcet.org 54 Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. Hassan Kehinde Bello and Kazeem Alagbe Gbolagade Abstract Biological sequence alignment is becoming popular
More informationPairwise Sequence Alignment. Zhongming Zhao, PhD
Pairwise Sequence Alignment Zhongming Zhao, PhD Email: zhongming.zhao@vanderbilt.edu http://bioinfo.mc.vanderbilt.edu/ Sequence Similarity match mismatch A T T A C G C G T A C C A T A T T A T G C G A T
More informationBiochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA)
Biochemistry 324 Bioinformatics Multiple Sequence Alignment (MSA) Big- Οh notation Greek omicron symbol Ο The Big-Oh notation indicates the complexity of an algorithm in terms of execution speed and storage
More informationDistributed Protein Sequence Alignment
Distributed Protein Sequence Alignment ABSTRACT J. Michael Meehan meehan@wwu.edu James Hearne hearne@wwu.edu Given the explosive growth of biological sequence databases and the computational complexity
More informationA Design of a Hybrid System for DNA Sequence Alignment
IMECS 2008, 9-2 March, 2008, Hong Kong A Design of a Hybrid System for DNA Sequence Alignment Heba Khaled, Hossam M. Faheem, Tayseer Hasan, Saeed Ghoneimy Abstract This paper describes a parallel algorithm
More informationBLAST MCDB 187. Friday, February 8, 13
BLAST MCDB 187 BLAST Basic Local Alignment Sequence Tool Uses shortcut to compute alignments of a sequence against a database very quickly Typically takes about a minute to align a sequence against a database
More informationOpinionated. Lessons. #52 Dynamic Programming. in Statistics. by Bill Press
Opinionated Lessons in Statistics by Bill Press #52 Dynamic Programming Professor William H. Press, Department of Computer Science, the University of Texas at Austin 1 Dynamic Programming Shortest path
More informationCHAPTER-6 WEB USAGE MINING USING CLUSTERING
CHAPTER-6 WEB USAGE MINING USING CLUSTERING 6.1 Related work in Clustering Technique 6.2 Quantifiable Analysis of Distance Measurement Techniques 6.3 Approaches to Formation of Clusters 6.4 Conclusion
More informationBLAST & Genome assembly
BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies May 15, 2014 1 BLAST What is BLAST? The algorithm 2 Genome assembly De novo assembly Mapping assembly 3
More informationBasic Local Alignment Search Tool (BLAST)
BLAST 26.04.2018 Basic Local Alignment Search Tool (BLAST) BLAST (Altshul-1990) is an heuristic Pairwise Alignment composed by six-steps that search for local similarities. The most used access point to
More informationA CAM(Content Addressable Memory)-based architecture for molecular sequence matching
A CAM(Content Addressable Memory)-based architecture for molecular sequence matching P.K. Lala 1 and J.P. Parkerson 2 1 Department Electrical Engineering, Texas A&M University, Texarkana, Texas, USA 2
More informationBrief review from last class
Sequence Alignment Brief review from last class DNA is has direction, we will use only one (5 -> 3 ) and generate the opposite strand as needed. DNA is a 3D object (see lecture 1) but we will model it
More informationDNA Alignment With Affine Gap Penalties
DNA Alignment With Affine Gap Penalties Laurel Schuster Why Use Affine Gap Penalties? When aligning two DNA sequences, one goal may be to infer the mutations that made them different. Though it s impossible
More informationAlgorithms in Bioinformatics: A Practical Introduction. Database Search
Algorithms in Bioinformatics: A Practical Introduction Database Search Biological databases Biological data is double in size every 15 or 16 months Increasing in number of queries: 40,000 queries per day
More informationCISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Sequence pairwise alignment Score statistics: E-value and p-value Heuristic algorithms: BLAST and FASTA Database search: gene finding and annotations
More informationChapter 6. Multiple sequence alignment (week 10)
Course organization Introduction ( Week 1,2) Part I: Algorithms for Sequence Analysis (Week 1-11) Chapter 1-3, Models and theories» Probability theory and Statistics (Week 3)» Algorithm complexity analysis
More informationKeywords -Bioinformatics, sequence alignment, Smith- waterman (SW) algorithm, GPU, CUDA
Volume 5, Issue 5, May 2015 ISSN: 2277 128X International Journal of Advanced Research in Computer Science and Software Engineering Research Paper Available online at: www.ijarcsse.com Accelerating Smith-Waterman
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 04: Variations of sequence alignments http://www.pitt.edu/~mcs2/teaching/biocomp/tutorials/global.html Slides adapted from Dr. Shaojie Zhang (University
More informationReconstructing long sequences from overlapping sequence fragment. Searching databases for related sequences and subsequences
SEQUENCE ALIGNMENT ALGORITHMS 1 Why compare sequences? Reconstructing long sequences from overlapping sequence fragment Searching databases for related sequences and subsequences Storing, retrieving and
More informationLectures 12 and 13 Dynamic programming: weighted interval scheduling
Lectures 12 and 13 Dynamic programming: weighted interval scheduling COMP 523: Advanced Algorithmic Techniques Lecturer: Dariusz Kowalski Lectures 12-13: Dynamic Programming 1 Overview Last week: Graph
More informationProfiles and Multiple Alignments. COMP 571 Luay Nakhleh, Rice University
Profiles and Multiple Alignments COMP 571 Luay Nakhleh, Rice University Outline Profiles and sequence logos Profile hidden Markov models Aligning profiles Multiple sequence alignment by gradual sequence
More information1 Dynamic Programming
Recitation 13 Dynamic Programming Parallel and Sequential Data Structures and Algorithms, 15-210 (Fall 2013) November 20, 2013 1 Dynamic Programming Dynamic programming is a technique to avoid needless
More informationCPSC 340: Machine Learning and Data Mining
CPSC 340: Machine Learning and Data Mining Feature Selection Original version of these slides by Mark Schmidt, with modifications by Mike Gelbart. Admin Assignment 3: Due Friday Midterm: Feb 14 in class
More informationIndexing and Searching
Indexing and Searching Introduction How to retrieval information? A simple alternative is to search the whole text sequentially Another option is to build data structures over the text (called indices)
More informationMouse, Human, Chimpanzee
More Alignments 1 Mouse, Human, Chimpanzee Mouse to Human Chimpanzee to Human 2 Mouse v.s. Human Chromosome X of Mouse to Human 3 Local Alignment Given: two sequences S and T Find: substrings of S and
More informationBMI/CS 576 Fall 2015 Midterm Exam
BMI/CS 576 Fall 2015 Midterm Exam Prof. Colin Dewey Tuesday, October 27th, 2015 11:00am-12:15pm Name: KEY Write your answers on these pages and show your work. You may use the back sides of pages as necessary.
More informationAlignment ABC. Most slides are modified from Serafim s lectures
Alignment ABC Most slides are modified from Serafim s lectures Complete genomes Evolution Evolution at the DNA level C ACGGTGCAGTCACCA ACGTTGCAGTCCACCA SEQUENCE EDITS REARRANGEMENTS Sequence conservation
More informationLecture 10: Local Alignments
Lecture 10: Local Alignments Study Chapter 6.8-6.10 1 Outline Edit Distances Longest Common Subsequence Global Sequence Alignment Scoring Matrices Local Sequence Alignment Alignment with Affine Gap Penalties
More information24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:
24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid
More informationBLAST. Basic Local Alignment Search Tool. Used to quickly compare a protein or DNA sequence to a database.
BLAST Basic Local Alignment Search Tool Used to quickly compare a protein or DNA sequence to a database. There is no such thing as a free lunch BLAST is fast and highly sensitive compared to competitors.
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 06: Multiple Sequence Alignment https://upload.wikimedia.org/wikipedia/commons/thumb/7/79/rplp0_90_clustalw_aln.gif/575px-rplp0_90_clustalw_aln.gif Slides
More informationSWAMP: Smith-Waterman using Associative Massive Parallelism
SWAMP: Smith-Waterman using Associative Massive Parallelism Shannon Steinfadt Dr. Johnnie W. Baker Department of Computer Science, Kent State University, Kent, Ohio 44242 USA ssteinfa@cs.kent.edu jbaker@cs.kent.edu
More informationChapter 8 Multiple sequence alignment. Chaochun Wei Spring 2018
1896 1920 1987 2006 Chapter 8 Multiple sequence alignment Chaochun Wei Spring 2018 Contents 1. Reading materials 2. Multiple sequence alignment basic algorithms and tools how to improve multiple alignment
More informationLesson 2 7 Graph Partitioning
Lesson 2 7 Graph Partitioning The Graph Partitioning Problem Look at the problem from a different angle: Let s multiply a sparse matrix A by a vector X. Recall the duality between matrices and graphs:
More informationSequence Alignment (chapter 6) p The biological problem p Global alignment p Local alignment p Multiple alignment
Sequence lignment (chapter 6) p The biological problem p lobal alignment p Local alignment p Multiple alignment Local alignment: rationale p Otherwise dissimilar proteins may have local regions of similarity
More informationHardware Accelerator for Biological Sequence Alignment using Coreworks Processing Engine
Hardware Accelerator for Biological Sequence Alignment using Coreworks Processing Engine José Cabrita, Gilberto Rodrigues, Paulo Flores INESC-ID / IST, Technical University of Lisbon jpmcabrita@gmail.com,
More informationToday s Lecture. Multiple sequence alignment. Improved scoring of pairwise alignments. Affine gap penalties Profiles
Today s Lecture Multiple sequence alignment Improved scoring of pairwise alignments Affine gap penalties Profiles 1 The Edit Graph for a Pair of Sequences G A C G T T G A A T G A C C C A C A T G A C G
More information.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar..
.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. PAM and BLOSUM Matrices Prepared by: Jason Banich and Chris Hoover Background As DNA sequences change and evolve, certain amino acids are more
More informationPairwise Sequence alignment Basic Algorithms
Pairwise Sequence alignment Basic Algorithms Agenda - Previous Lesson: Minhala - + Biological Story on Biomolecular Sequences - + General Overview of Problems in Computational Biology - Reminder: Dynamic
More informationLecture 5: Multiple sequence alignment
Lecture 5: Multiple sequence alignment Introduction to Computational Biology Teresa Przytycka, PhD (with some additions by Martin Vingron) Why do we need multiple sequence alignment Pairwise sequence alignment
More informationBLAST, Profile, and PSI-BLAST
BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources
More informationBLAST & Genome assembly
BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies November 17, 2012 1 Introduction Introduction 2 BLAST What is BLAST? The algorithm 3 Genome assembly De
More informationAlignment of Long Sequences
Alignment of Long Sequences BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2009 Mark Craven craven@biostat.wisc.edu Pairwise Whole Genome Alignment: Task Definition Given a pair of genomes (or other large-scale
More informationBGGN 213 Foundations of Bioinformatics Barry Grant
BGGN 213 Foundations of Bioinformatics Barry Grant http://thegrantlab.org/bggn213 Recap From Last Time: 25 Responses: https://tinyurl.com/bggn213-02-f17 Why ALIGNMENT FOUNDATIONS Why compare biological
More informationA Hybrid Heuristic/Deterministic Dynamic Programing Technique for Fast Sequence Alignment
Vol 6, No 8, 25 A Hybrid Heuristic/Deterministic Dynamic Programing Technique for Fast Sequence Alignment Talal Bonny Department of Electrical and Computer Engineering College of Engineering University
More informationCentralities (4) By: Ralucca Gera, NPS. Excellence Through Knowledge
Centralities (4) By: Ralucca Gera, NPS Excellence Through Knowledge Some slide from last week that we didn t talk about in class: 2 PageRank algorithm Eigenvector centrality: i s Rank score is the sum
More informationThe Effect of Inverse Document Frequency Weights on Indexed Sequence Retrieval. Kevin C. O'Kane. Department of Computer Science
The Effect of Inverse Document Frequency Weights on Indexed Sequence Retrieval Kevin C. O'Kane Department of Computer Science The University of Northern Iowa Cedar Falls, Iowa okane@cs.uni.edu http://www.cs.uni.edu/~okane
More informationModified Distribution Method
istributors C 8 Step : Make an initial allocation with the North-West corner rule. KPP istributors C 8 V j Step : Make an initial allocation with the North-West corner rule. Step : Introduce the variables,
More informationSimilarity Searches on Sequence Databases
Similarity Searches on Sequence Databases Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Zürich, October 2004 Swiss Institute of Bioinformatics Swiss EMBnet node Outline Importance of
More informationResearch Article International Journals of Advanced Research in Computer Science and Software Engineering ISSN: X (Volume-7, Issue-6)
International Journals of Advanced Research in Computer Science and Software Engineering ISSN: 77-18X (Volume-7, Issue-6) Research Article June 017 DDGARM: Dotlet Driven Global Alignment with Reduced Matrix
More informationEECS 4425: Introductory Computational Bioinformatics Fall Suprakash Datta
EECS 4425: Introductory Computational Bioinformatics Fall 2018 Suprakash Datta datta [at] cse.yorku.ca Office: CSEB 3043 Phone: 416-736-2100 ext 77875 Course page: http://www.cse.yorku.ca/course/4425 Many
More informationPairwise alignment II
Pairwise alignment II Agenda - Previous Lesson: Minhala + Introduction - Review Dynamic Programming - Pariwise Alignment Biological Motivation Today: - Quick Review: Sequence Alignment (Global, Local,
More informationMultiple Sequence Alignment. Mark Whitsitt - NCSA
Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV
More informationAlignment and clustering tools for sequence analysis. Omar Abudayyeh Presentation December 9, 2015
Alignment and clustering tools for sequence analysis Omar Abudayyeh 18.337 Presentation December 9, 2015 Introduction Sequence comparison is critical for inferring biological relationships within large
More informationGLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment
GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment Scoring Dynamic Programming algorithms Heuristic algorithms CLUSTAL W Courtesy of jalview Motivations Collective (or aggregate) statistic
More informationDarwin-WGA. A Co-processor Provides Increased Sensitivity in Whole Genome Alignments with High Speedup
Darwin-WGA A Co-processor Provides Increased Sensitivity in Whole Genome Alignments with High Speedup Yatish Turakhia*, Sneha D. Goenka*, Prof. Gill Bejerano, Prof. William J. Dally * Equal contribution
More informationAcceleration of the Smith-Waterman algorithm for DNA sequence alignment using an FPGA platform
Acceleration of the Smith-Waterman algorithm for DNA sequence alignment using an FPGA platform Barry Strengholt Matthijs Brobbel Delft University of Technology Faculty of Electrical Engineering, Mathematics
More information