Sequence comparison: Local alignment
|
|
- Theodora White
- 5 years ago
- Views:
Transcription
1 Sequence comparison: Local alignment Genome 559: Introuction to Statistical an Computational Genomics Prof. James H. Thomas
2 Review global alignment en traceback G A A T C C A T A C Fill DP matrix from upper left to lower right, trace back alignment from lower right corner. start traceback
3 FYI - informal inuctive proof of best alignment path Consier the last step in the best alignment path to noe a below from its ajacent noes, where X, Y, an Z are scores of the best alignments up to those noes. We can reach noe a by three possible paths: an A-B match, a gap in sequence A or a gap in sequence B: X seq A Y The best-scoring path to a is the maximum of: seq B Z match gap gap a X + match Y + gap Z + gap BUT the best paths to X, Y, an Z are analogously the max of their three upstream possibilities, etc. Inuctively QED.
4 Local alignment A single-omain protein may be similar to only one region within a multi-omain protein. A DNA query may align to a small part of a genome. An alignment that spans the complete length of both sequences may be unesirable.
5 BLAST oes local alignments Typical search has a short query against long targets. The alignments returne show only the well-aligne match region of both query an target. query targets (e.g. genome contigs) matche regions returne in alignment
6 Review - global alignment DP Align sequence x an y. F is the DP matrix; s is the substitution matrix; is the linear gap penalty. j i F j i F y x s j i F j i F F j i 1, 1,, 1 1, max,,
7 Local alignment DP Align sequence x an y. F is the DP matrix; s is the substitution matrix; is the linear gap penalty. 1, 1,, 1 1, max,, j i F j i F y x s j i F j i F F j i for local
8 A (very) simple example initialize the same way as for global alignment = -5 A F i 1, j 1 j 1 G C F i 1, j j
9 A simple example = -5 A? F i 1, j 1 j 1 G? C? F i 1, j j
10 A simple example = -5 A? F i 1, j 1 j 1 G C F i 1, j j
11 A simple example = -5 A F i 1, j 1 j 1 G C F i 1, j j
12 A A A simple example = -5 A 2 F i 1, j 1 j 1 G C F i 1, j j
13 A simple example = -5 A 2 F i 1, j 1 j 1 G? C? F i 1, j j
14 A simple example = -5 A 2 F i 1, j 1 j 1 G C F i 1, j j
15 A simple example = -5 A 2 F i 1, j 1 j 1 G C F i 1, j j (signify no preceing alignment with no arrow)
16 A simple example = -5 A 2? F i 1, j 1 j 1 G? C? F i 1, j j (signify no preceing alignment with no arrow)
17 A simple example = -5 A 2 2 F i 1, j 1 j 1 G C F i 1, j j
18 A simple example = -5 A 2 2? F i 1, j 1 j 1 G? C? F i 1, j j
19 A simple example = -5 A 2 2 F i 1, j 1 j 1 G 4 C F i 1, j j
20 Traceback AG AG = -5 A 2 2 G 4 F i 1, j 1 j 1 C F i 1, j j Start traceback at highest score anywhere in matrix, follow arrows back until you reach
21 Multiple local alignments Traceback from highest score, setting each DP matrix score along traceback to zero. Now traceback from the remaining highest score, etc. The alignments may or may not inclue the same parts of the two sequences. 2 1
22 Local alignment Two ifferences from global alignment: If a DP score is negative, replace with. Traceback from the highest score in the matrix an continue until you reach. Global alignment algorithm: Neeleman- Wunsch. Local alignment algorithm: Smith- Waterman.
23
24 (some) specific uses for alignments make a pairwise or multiple alignment (uh) test whether two sequences share a common ancestor (i.e. are significantly relate) fin matches to a sequence in a large atabase buil a sequence tree (phylogenetic tree) make a genome assembly (fin overlaps of sequence reas) repeat-mask a genome sequence (fin matches to a atabase of known repeats) map sequence reas to a reference genome
25 F i 1, j 1 F i 1, j Another example j Fin the optimal local alignment of AAG an GAAGGC. Use a gap penalty of = -5. j 1 G 2 A 2 2 A 2 4 G 6 G 2 C
26 Traceback G 2 A 2 2 A 2 4 G 6 G 2 C AAG AAG
27 G A A G G C DP matrix Traceback matrix You on t actually nee first row an column (-1) (-1) (-1) (-1) (-1) -1-1 (-1) -1 (-1) -1 (-1) -1-1 (-1) -1-1 (-1) = iagonal, -1 = gap left, +1 = gap top, -1 = no alignment
28 Problem fin the best GLOBAL alignment F i 1, j 1 F i 1, j j Fin the optimal global alignment of AAG an GAAGGC. Use a gap penalty of = -5. j 1 G -5 A -1 A -15 G -2 G -25 C (contrast with the best local alignment)
Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014
Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into
More informationBiology 644: Bioinformatics
Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find
More informationSequence Comparison: Dynamic Programming. Genome 373 Genomic Informatics Elhanan Borenstein
Sequence omparison: Dynamic Programming Genome 373 Genomic Informatics Elhanan Borenstein quick review: hallenges Find the best global alignment of two sequences Find the best global alignment of multiple
More informationLecture 10. Sequence alignments
Lecture 10 Sequence alignments Alignment algorithms: Overview Given a scoring system, we need to have an algorithm for finding an optimal alignment for a pair of sequences. We want to maximize the score
More informationAlgorithmic Approaches for Biological Data, Lecture #20
Algorithmic Approaches for Biological Data, Lecture #20 Katherine St. John City University of New York American Museum of Natural History 20 April 2016 Outline Aligning with Gaps and Substitution Matrices
More informationSequence analysis Pairwise sequence alignment
UMF11 Introduction to bioinformatics, 25 Sequence analysis Pairwise sequence alignment 1. Sequence alignment Lecturer: Marina lexandersson 12 September, 25 here are two types of sequence alignments, global
More informationPairwise Sequence Alignment: Dynamic Programming Algorithms. COMP Spring 2015 Luay Nakhleh, Rice University
Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 - Spring 2015 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment The number of all possible pairwise alignments (if
More informationPairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University
1 Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment 2 The number of all possible pairwise alignments (if gaps are allowed)
More informationComputational Genomics and Molecular Biology, Fall
Computational Genomics and Molecular Biology, Fall 2015 1 Sequence Alignment Dannie Durand Pairwise Sequence Alignment The goal of pairwise sequence alignment is to establish a correspondence between the
More informationSequence Alignment. part 2
Sequence Alignment part 2 Dynamic programming with more realistic scoring scheme Using the same initial sequences, we ll look at a dynamic programming example with a scoring scheme that selects for matches
More informationSequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it.
Sequence Alignments Overview Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it. Sequence alignment means arranging
More informationLecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:
Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating
More informationBrief review from last class
Sequence Alignment Brief review from last class DNA is has direction, we will use only one (5 -> 3 ) and generate the opposite strand as needed. DNA is a 3D object (see lecture 1) but we will model it
More informationSequence Alignment & Search
Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version
More informationBLAST & Genome assembly
BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies May 15, 2014 1 BLAST What is BLAST? The algorithm 2 Genome assembly De novo assembly Mapping assembly 3
More informationNotes on Dynamic-Programming Sequence Alignment
Notes on Dynamic-Programming Sequence Alignment Introduction. Following its introduction by Needleman and Wunsch (1970), dynamic programming has become the method of choice for rigorous alignment of DNA
More informationAlignment of Long Sequences
Alignment of Long Sequences BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2009 Mark Craven craven@biostat.wisc.edu Pairwise Whole Genome Alignment: Task Definition Given a pair of genomes (or other large-scale
More informationCOS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1. Database Searching
COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1 Database Searching In database search, we typically have a large sequence database
More informationOutline. Sequence Alignment. Types of Sequence Alignment. Genomics & Computational Biology. Section 2. How Computers Store Information
enomics & omputational Biology Section Lan Zhang Sep. th, Outline How omputers Store Information Sequence lignment Dot Matrix nalysis Dynamic programming lobal: NeedlemanWunsch lgorithm Local: SmithWaterman
More informationBLAST & Genome assembly
BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies November 17, 2012 1 Introduction Introduction 2 BLAST What is BLAST? The algorithm 3 Genome assembly De
More informationBioinformatics explained: Smith-Waterman
Bioinformatics Explained Bioinformatics explained: Smith-Waterman May 1, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com
More informationCISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment
CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features
More informationPairwise Sequence Alignment. Zhongming Zhao, PhD
Pairwise Sequence Alignment Zhongming Zhao, PhD Email: zhongming.zhao@vanderbilt.edu http://bioinfo.mc.vanderbilt.edu/ Sequence Similarity match mismatch A T T A C G C G T A C C A T A T T A T G C G A T
More informationBGGN 213 Foundations of Bioinformatics Barry Grant
BGGN 213 Foundations of Bioinformatics Barry Grant http://thegrantlab.org/bggn213 Recap From Last Time: 25 Responses: https://tinyurl.com/bggn213-02-f17 Why ALIGNMENT FOUNDATIONS Why compare biological
More informationOPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT
OPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT Asif Ali Khan*, Laiq Hassan*, Salim Ullah* ABSTRACT: In bioinformatics, sequence alignment is a common and insistent task. Biologists align
More informationToday s Lecture. Edit graph & alignment algorithms. Local vs global Computational complexity of pairwise alignment Multiple sequence alignment
Today s Lecture Edit graph & alignment algorithms Smith-Waterman algorithm Needleman-Wunsch algorithm Local vs global Computational complexity of pairwise alignment Multiple sequence alignment 1 Sequence
More informationPrinciples of Bioinformatics. BIO540/STA569/CSI660 Fall 2010
Principles of Bioinformatics BIO540/STA569/CSI660 Fall 2010 Lecture 11 Multiple Sequence Alignment I Administrivia Administrivia The midterm examination will be Monday, October 18 th, in class. Closed
More informationBLAST MCDB 187. Friday, February 8, 13
BLAST MCDB 187 BLAST Basic Local Alignment Sequence Tool Uses shortcut to compute alignments of a sequence against a database very quickly Typically takes about a minute to align a sequence against a database
More informationDistributed Protein Sequence Alignment
Distributed Protein Sequence Alignment ABSTRACT J. Michael Meehan meehan@wwu.edu James Hearne hearne@wwu.edu Given the explosive growth of biological sequence databases and the computational complexity
More informationIn this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace.
5 Multiple Match Refinement and T-Coffee In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace. This exposition
More informationAn Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST
An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise
More informationCompares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.
Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the
More informationA CAM(Content Addressable Memory)-based architecture for molecular sequence matching
A CAM(Content Addressable Memory)-based architecture for molecular sequence matching P.K. Lala 1 and J.P. Parkerson 2 1 Department Electrical Engineering, Texas A&M University, Texarkana, Texas, USA 2
More informationProgramming assignment for the course Sequence Analysis (2006)
Programming assignment for the course Sequence Analysis (2006) Original text by John W. Romein, adapted by Bart van Houte (bart@cs.vu.nl) Introduction Please note: This assignment is only obligatory for
More information24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:
24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid
More informationPairwise alignment II
Pairwise alignment II Agenda - Previous Lesson: Minhala + Introduction - Review Dynamic Programming - Pariwise Alignment Biological Motivation Today: - Quick Review: Sequence Alignment (Global, Local,
More informationPairwise Sequence alignment Basic Algorithms
Pairwise Sequence alignment Basic Algorithms Agenda - Previous Lesson: Minhala - + Biological Story on Biomolecular Sequences - + General Overview of Problems in Computational Biology - Reminder: Dynamic
More informationBIOL591: Introduction to Bioinformatics Alignment of pairs of sequences
BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences Reading in text (Mount Bioinformatics): I must confess that the treatment in Mount of sequence alignment does not seem to me a model
More informationLecture 3: February Local Alignment: The Smith-Waterman Algorithm
CSCI1820: Sequence Alignment Spring 2017 Lecture 3: February 7 Lecturer: Sorin Istrail Scribe: Pranavan Chanthrakumar Note: LaTeX template courtesy of UC Berkeley EECS dept. Notes are also adapted from
More informationBMI/CS 576 Fall 2015 Midterm Exam
BMI/CS 576 Fall 2015 Midterm Exam Prof. Colin Dewey Tuesday, October 27th, 2015 11:00am-12:15pm Name: KEY Write your answers on these pages and show your work. You may use the back sides of pages as necessary.
More informationBiochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA)
Biochemistry 324 Bioinformatics Multiple Sequence Alignment (MSA) Big- Οh notation Greek omicron symbol Ο The Big-Oh notation indicates the complexity of an algorithm in terms of execution speed and storage
More informationCMSC423: Bioinformatic Algorithms, Databases and Tools Lecture 8. Note
MS: Bioinformatic lgorithms, Databases and ools Lecture 8 Sequence alignment: inexact alignment dynamic programming, gapped alignment Note Lecture 7 suffix trees and suffix arrays will be rescheduled Exact
More informationDarwin-WGA. A Co-processor Provides Increased Sensitivity in Whole Genome Alignments with High Speedup
Darwin-WGA A Co-processor Provides Increased Sensitivity in Whole Genome Alignments with High Speedup Yatish Turakhia*, Sneha D. Goenka*, Prof. Gill Bejerano, Prof. William J. Dally * Equal contribution
More informationCS313 Exercise 4 Cover Page Fall 2017
CS313 Exercise 4 Cover Page Fall 2017 Due by the start of class on Thursday, October 12, 2017. Name(s): In the TIME column, please estimate the time you spent on the parts of this exercise. Please try
More informationFASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm.
FASTA INTRODUCTION Definition (by David J. Lipman and William R. Pearson in 1985) - Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence
More informationComputational Biology Lecture 4: Overlap detection, Local Alignment, Space Efficient Needleman-Wunsch Saad Mneimneh
Computational Biology Lecture 4: Overlap detection, Local Alignment, Space Efficient Needleman-Wunsch Saad Mneimneh Overlap detection: Semi-Global Alignment An overlap of two sequences is considered an
More informationDynamic Programming & Smith-Waterman algorithm
m m Seminar: Classical Papers in Bioinformatics May 3rd, 2010 m m 1 2 3 m m Introduction m Definition is a method of solving problems by breaking them down into simpler steps problem need to contain overlapping
More informationBLAST, Profile, and PSI-BLAST
BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources
More informationAccelerating Smith Waterman (SW) Algorithm on Altera Cyclone II Field Programmable Gate Array
Accelerating Smith Waterman (SW) Algorithm on Altera yclone II Field Programmable Gate Array NUR DALILAH AHMAD SABRI, NUR FARAH AIN SALIMAN, SYED ABDUL MUALIB AL JUNID, ABDUL KARIMI HALIM Faculty Electrical
More informationBLAST - Basic Local Alignment Search Tool
Lecture for ic Bioinformatics (DD2450) April 11, 2013 Searching 1. Input: Query Sequence 2. Database of sequences 3. Subject Sequence(s) 4. Output: High Segment Pairs (HSPs) Sequence Similarity Measures:
More information.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar..
.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. PAM and BLOSUM Matrices Prepared by: Jason Banich and Chris Hoover Background As DNA sequences change and evolve, certain amino acids are more
More informationToday s Lecture. Multiple sequence alignment. Improved scoring of pairwise alignments. Affine gap penalties Profiles
Today s Lecture Multiple sequence alignment Improved scoring of pairwise alignments Affine gap penalties Profiles 1 The Edit Graph for a Pair of Sequences G A C G T T G A A T G A C C C A C A T G A C G
More informationFrom Smith-Waterman to BLAST
From Smith-Waterman to BLAST Jeremy Buhler July 23, 2015 Smith-Waterman is the fundamental tool that we use to decide how similar two sequences are. Isn t that all that BLAST does? In principle, it is
More informationDarwin: A Genomic Co-processor gives up to 15,000X speedup on long read assembly (To appear in ASPLOS 2018)
Darwin: A Genomic Co-processor gives up to 15,000X speedup on long read assembly (To appear in ASPLOS 2018) Yatish Turakhia EE PhD candidate Stanford University Prof. Bill Dally (Electrical Engineering
More informationAlignment and clustering tools for sequence analysis. Omar Abudayyeh Presentation December 9, 2015
Alignment and clustering tools for sequence analysis Omar Abudayyeh 18.337 Presentation December 9, 2015 Introduction Sequence comparison is critical for inferring biological relationships within large
More informationSequence alignment theory and applications Session 3: BLAST algorithm
Sequence alignment theory and applications Session 3: BLAST algorithm Introduction to Bioinformatics online course : IBT Sonal Henson Learning Objectives Understand the principles of the BLAST algorithm
More informationBioinformatics for Biologists
Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover
More informationMouse, Human, Chimpanzee
More Alignments 1 Mouse, Human, Chimpanzee Mouse to Human Chimpanzee to Human 2 Mouse v.s. Human Chromosome X of Mouse to Human 3 Local Alignment Given: two sequences S and T Find: substrings of S and
More informationScalable Accelerator Architecture for Local Alignment of DNA Sequences
Scalable Accelerator Architecture for Local Alignment of DNA Sequences Nuno Sebastião, Nuno Roma, Paulo Flores INESC-ID / IST-TU Lisbon Rua Alves Redol, 9, Lisboa PORTUGAL {Nuno.Sebastiao, Nuno.Roma, Paulo.Flores}
More informationGenomic Finishing & Consed
Genomic Finishing & Consed SEA stages of genomic analysis Draft vs Finished Draft Sequence Single sequencing approach Limited human intervention Cheap, Fast Finished sequence Multiple approaches Human
More informationAlignment ABC. Most slides are modified from Serafim s lectures
Alignment ABC Most slides are modified from Serafim s lectures Complete genomes Evolution Evolution at the DNA level C ACGGTGCAGTCACCA ACGTTGCAGTCCACCA SEQUENCE EDITS REARRANGEMENTS Sequence conservation
More informationBLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha
BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio. 1990. CS 466 Saurabh Sinha Motivation Sequence homology to a known protein suggest function of newly sequenced protein Bioinformatics
More informationLecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD
Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Assumptions: Biological sequences evolved by evolution. Micro scale changes: For short sequences (e.g. one
More informationMultiple Sequence Alignment. Mark Whitsitt - NCSA
Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV
More informationBLAST. NCBI BLAST Basic Local Alignment Search Tool
BLAST NCBI BLAST Basic Local Alignment Search Tool http://www.ncbi.nlm.nih.gov/blast/ Global versus local alignments Global alignments: Attempt to align every residue in every sequence, Most useful when
More informationProfiles and Multiple Alignments. COMP 571 Luay Nakhleh, Rice University
Profiles and Multiple Alignments COMP 571 Luay Nakhleh, Rice University Outline Profiles and sequence logos Profile hidden Markov models Aligning profiles Multiple sequence alignment by gradual sequence
More informationB L A S T! BLAST: Basic local alignment search tool. Copyright notice. February 6, Pairwise alignment: key points. Outline of tonight s lecture
February 6, 2008 BLAST: Basic local alignment search tool B L A S T! Jonathan Pevsner, Ph.D. Introduction to Bioinformatics pevsner@jhmi.edu 4.633.0 Copyright notice Many of the images in this powerpoint
More informationBasic Local Alignment Search Tool (BLAST)
BLAST 26.04.2018 Basic Local Alignment Search Tool (BLAST) BLAST (Altshul-1990) is an heuristic Pairwise Alignment composed by six-steps that search for local similarities. The most used access point to
More informationBIOINFORMATICS A PRACTICAL GUIDE TO THE ANALYSIS OF GENES AND PROTEINS
BIOINFORMATICS A PRACTICAL GUIDE TO THE ANALYSIS OF GENES AND PROTEINS EDITED BY Genome Technology Branch National Human Genome Research Institute National Institutes of Health Bethesda, Maryland B. F.
More informationFastA & the chaining problem
FastA & the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 1 Sources for this lecture: Lectures by Volker Heun, Daniel Huson and Knut Reinert,
More informationAlgorithms and Tools for Bioinformatics on GPUs. Bertil SCHMIDT
Algorithms and Tools for Bioinformatics on GPUs Bertil SCHMIDT Contents Motivation Pairwise Sequence Alignment Multiple Sequence Alignment Short Read Error Correction using CUDA Some other CUDA-enabled
More informationFastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:
FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:56 4001 4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem
More informationSequence alignment algorithms
Sequence alignment algorithms Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 23 rd 27 After this lecture, you can decide when to use local and global sequence alignments
More informationComputational Molecular Biology
Computational Molecular Biology Erwin M. Bakker Lecture 2 Materials used from R. Shamir [2] and H.J. Hoogeboom [4]. 1 Molecular Biology Sequences DNA A, T, C, G RNA A, U, C, G Protein A, R, D, N, C E,
More informationTCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology?
Local Sequence Alignment & Heuristic Local Aligners Lectures 18 Nov 28, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall
More informationSimilarity Searches on Sequence Databases
Similarity Searches on Sequence Databases Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Zürich, October 2004 Swiss Institute of Bioinformatics Swiss EMBnet node Outline Importance of
More informationComputational Molecular Biology
Computational Molecular Biology Erwin M. Bakker Lecture 3, mainly from material by R. Shamir [2] and H.J. Hoogeboom [4]. 1 Pairwise Sequence Alignment Biological Motivation Algorithmic Aspect Recursive
More informationSequencing Alignment I
Sequencing Alignment I Lectures 16 Nov 21, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall (JHN) 022 1 Outline: Sequence
More informationJyoti Lakhani 1, Ajay Khunteta 2, Dharmesh Harwani *3 1 Poornima University, Jaipur & Maharaja Ganga Singh University, Bikaner, Rajasthan, India
International Journal of Scientific Research in Computer Science, Engineering and Information Technology 2017 IJSRCSEIT Volume 2 Issue 6 ISSN : 2456-3307 Improvisation of Global Pairwise Sequence Alignment
More informationDynamic Programming Part I: Examples. Bioinfo I (Institut Pasteur de Montevideo) Dynamic Programming -class4- July 25th, / 77
Dynamic Programming Part I: Examples Bioinfo I (Institut Pasteur de Montevideo) Dynamic Programming -class4- July 25th, 2011 1 / 77 Dynamic Programming Recall: the Change Problem Other problems: Manhattan
More informationKeywords -Bioinformatics, sequence alignment, Smith- waterman (SW) algorithm, GPU, CUDA
Volume 5, Issue 5, May 2015 ISSN: 2277 128X International Journal of Advanced Research in Computer Science and Software Engineering Research Paper Available online at: www.ijarcsse.com Accelerating Smith-Waterman
More informationRead Mapping. Slides by Carl Kingsford
Read Mapping Slides by Carl Kingsford Bowtie Ultrafast and memory-efficient alignment of short DNA sequences to the human genome Ben Langmead, Cole Trapnell, Mihai Pop and Steven L Salzberg, Genome Biology
More informationSimilarity searches in biological sequence databases
Similarity searches in biological sequence databases Volker Flegel september 2004 Page 1 Outline Keyword search in databases General concept Examples SRS Entrez Expasy Similarity searches in databases
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 04: Variations of sequence alignments http://www.pitt.edu/~mcs2/teaching/biocomp/tutorials/global.html Slides adapted from Dr. Shaojie Zhang (University
More informationA Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity
A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity G. Pratyusha, Department of Computer Science & Engineering, V.R.Siddhartha Engineering College(Autonomous)
More informationSequence Alignment (chapter 6) p The biological problem p Global alignment p Local alignment p Multiple alignment
Sequence lignment (chapter 6) p The biological problem p lobal alignment p Local alignment p Multiple alignment Local alignment: rationale p Otherwise dissimilar proteins may have local regions of similarity
More informationPairwise alignment using shortest path algorithms, Gunnar Klau, November 29, 2005, 11:
airwise alignment using shortest path algorithms, Gunnar Klau, November 9,, : 3 3 airwise alignment using shortest path algorithms e will iscuss: it graph Dijkstra s algorithm algorithm (GDU) 3. References
More informationAcceleration of the Smith-Waterman algorithm for DNA sequence alignment using an FPGA platform
Acceleration of the Smith-Waterman algorithm for DNA sequence alignment using an FPGA platform Barry Strengholt Matthijs Brobbel Delft University of Technology Faculty of Electrical Engineering, Mathematics
More informationA Design of a Hybrid System for DNA Sequence Alignment
IMECS 2008, 9-2 March, 2008, Hong Kong A Design of a Hybrid System for DNA Sequence Alignment Heba Khaled, Hossam M. Faheem, Tayseer Hasan, Saeed Ghoneimy Abstract This paper describes a parallel algorithm
More informationBasics of Multiple Sequence Alignment
Basics of Multiple Sequence Alignment Tandy Warnow February 10, 2018 Basics of Multiple Sequence Alignment Tandy Warnow Basic issues What is a multiple sequence alignment? Evolutionary processes operating
More informationCentral Issues in Biological Sequence Comparison
Central Issues in Biological Sequence Comparison Definitions: What is one trying to find or optimize? Algorithms: Can one find the proposed object optimally or in reasonable time optimize? Statistics:
More informationMultiple Sequence Alignment Sum-of-Pairs and ClustalW. Ulf Leser
Multiple Sequence Alignment Sum-of-Pairs and ClustalW Ulf Leser This Lecture Multiple Sequence Alignment The problem Theoretical approach: Sum-of-Pairs scores Practical approach: ClustalW Ulf Leser: Bioinformatics,
More informationLectures by Volker Heun, Daniel Huson and Knut Reinert, in particular last years lectures
4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 4.1 Sources for this lecture Lectures by Volker Heun, Daniel Huson and Knut
More informationMultiple Sequence Alignment Augmented by Expert User Constraints
Multiple Sequence Alignment Augmented by Expert User Constraints A Thesis Submitted to the College of Graduate Studies and Research in Partial Fulfillment of the Requirements for the degree of Master of
More informationTour Guide for Windows and Macintosh
Tour Guide for Windows and Macintosh 2011 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Suite 100A, Ann Arbor, MI 48108 USA phone 1.800.497.4939 or 1.734.769.7249 (fax) 1.734.769.7074
More informationAcceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion.
www.ijarcet.org 54 Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. Hassan Kehinde Bello and Kazeem Alagbe Gbolagade Abstract Biological sequence alignment is becoming popular
More informationUnder the Hood of Alignment Algorithms for NGS Researchers
Under the Hood of Alignment Algorithms for NGS Researchers April 16, 2014 Gabe Rudy VP of Product Development Golden Helix Questions during the presentation Use the Questions pane in your GoToWebinar window
More informationProblem Paper Atoms Tree. atoms.pas. atoms.cpp. atoms.c. atoms.java. Time limit per test 1 second 1 second 2 seconds. Number of tests
! " # %$ & Overview Problem Paper Atoms Tree Shen Tian Harry Wiggins Carl Hultquist Program name paper.exe atoms.exe tree.exe Source name paper.pas atoms.pas tree.pas paper.cpp atoms.cpp tree.cpp paper.c
More informationDatabase Searching Using BLAST
Mahidol University Objectives SCMI512 Molecular Sequence Analysis Database Searching Using BLAST Lecture 2B After class, students should be able to: explain the FASTA algorithm for database searching explain
More informationQuiz section 10. June 1, 2018
Quiz section 10 June 1, 2018 Logistics Bring: 1 page cheat-sheet, simple calculator Any last logistics questions about the final? Logistics Bring: 1 page cheat-sheet, simple calculator Any last logistics
More information