Sequence comparison: Local alignment

Size: px
Start display at page:

Download "Sequence comparison: Local alignment"

Transcription

1 Sequence comparison: Local alignment Genome 559: Introuction to Statistical an Computational Genomics Prof. James H. Thomas

2 Review global alignment en traceback G A A T C C A T A C Fill DP matrix from upper left to lower right, trace back alignment from lower right corner. start traceback

3 FYI - informal inuctive proof of best alignment path Consier the last step in the best alignment path to noe a below from its ajacent noes, where X, Y, an Z are scores of the best alignments up to those noes. We can reach noe a by three possible paths: an A-B match, a gap in sequence A or a gap in sequence B: X seq A Y The best-scoring path to a is the maximum of: seq B Z match gap gap a X + match Y + gap Z + gap BUT the best paths to X, Y, an Z are analogously the max of their three upstream possibilities, etc. Inuctively QED.

4 Local alignment A single-omain protein may be similar to only one region within a multi-omain protein. A DNA query may align to a small part of a genome. An alignment that spans the complete length of both sequences may be unesirable.

5 BLAST oes local alignments Typical search has a short query against long targets. The alignments returne show only the well-aligne match region of both query an target. query targets (e.g. genome contigs) matche regions returne in alignment

6 Review - global alignment DP Align sequence x an y. F is the DP matrix; s is the substitution matrix; is the linear gap penalty. j i F j i F y x s j i F j i F F j i 1, 1,, 1 1, max,,

7 Local alignment DP Align sequence x an y. F is the DP matrix; s is the substitution matrix; is the linear gap penalty. 1, 1,, 1 1, max,, j i F j i F y x s j i F j i F F j i for local

8 A (very) simple example initialize the same way as for global alignment = -5 A F i 1, j 1 j 1 G C F i 1, j j

9 A simple example = -5 A? F i 1, j 1 j 1 G? C? F i 1, j j

10 A simple example = -5 A? F i 1, j 1 j 1 G C F i 1, j j

11 A simple example = -5 A F i 1, j 1 j 1 G C F i 1, j j

12 A A A simple example = -5 A 2 F i 1, j 1 j 1 G C F i 1, j j

13 A simple example = -5 A 2 F i 1, j 1 j 1 G? C? F i 1, j j

14 A simple example = -5 A 2 F i 1, j 1 j 1 G C F i 1, j j

15 A simple example = -5 A 2 F i 1, j 1 j 1 G C F i 1, j j (signify no preceing alignment with no arrow)

16 A simple example = -5 A 2? F i 1, j 1 j 1 G? C? F i 1, j j (signify no preceing alignment with no arrow)

17 A simple example = -5 A 2 2 F i 1, j 1 j 1 G C F i 1, j j

18 A simple example = -5 A 2 2? F i 1, j 1 j 1 G? C? F i 1, j j

19 A simple example = -5 A 2 2 F i 1, j 1 j 1 G 4 C F i 1, j j

20 Traceback AG AG = -5 A 2 2 G 4 F i 1, j 1 j 1 C F i 1, j j Start traceback at highest score anywhere in matrix, follow arrows back until you reach

21 Multiple local alignments Traceback from highest score, setting each DP matrix score along traceback to zero. Now traceback from the remaining highest score, etc. The alignments may or may not inclue the same parts of the two sequences. 2 1

22 Local alignment Two ifferences from global alignment: If a DP score is negative, replace with. Traceback from the highest score in the matrix an continue until you reach. Global alignment algorithm: Neeleman- Wunsch. Local alignment algorithm: Smith- Waterman.

23

24 (some) specific uses for alignments make a pairwise or multiple alignment (uh) test whether two sequences share a common ancestor (i.e. are significantly relate) fin matches to a sequence in a large atabase buil a sequence tree (phylogenetic tree) make a genome assembly (fin overlaps of sequence reas) repeat-mask a genome sequence (fin matches to a atabase of known repeats) map sequence reas to a reference genome

25 F i 1, j 1 F i 1, j Another example j Fin the optimal local alignment of AAG an GAAGGC. Use a gap penalty of = -5. j 1 G 2 A 2 2 A 2 4 G 6 G 2 C

26 Traceback G 2 A 2 2 A 2 4 G 6 G 2 C AAG AAG

27 G A A G G C DP matrix Traceback matrix You on t actually nee first row an column (-1) (-1) (-1) (-1) (-1) -1-1 (-1) -1 (-1) -1 (-1) -1-1 (-1) -1-1 (-1) = iagonal, -1 = gap left, +1 = gap top, -1 = no alignment

28 Problem fin the best GLOBAL alignment F i 1, j 1 F i 1, j j Fin the optimal global alignment of AAG an GAAGGC. Use a gap penalty of = -5. j 1 G -5 A -1 A -15 G -2 G -25 C (contrast with the best local alignment)

Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014

Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into

More information

Biology 644: Bioinformatics

Biology 644: Bioinformatics Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find

More information

Sequence Comparison: Dynamic Programming. Genome 373 Genomic Informatics Elhanan Borenstein

Sequence Comparison: Dynamic Programming. Genome 373 Genomic Informatics Elhanan Borenstein Sequence omparison: Dynamic Programming Genome 373 Genomic Informatics Elhanan Borenstein quick review: hallenges Find the best global alignment of two sequences Find the best global alignment of multiple

More information

Lecture 10. Sequence alignments

Lecture 10. Sequence alignments Lecture 10 Sequence alignments Alignment algorithms: Overview Given a scoring system, we need to have an algorithm for finding an optimal alignment for a pair of sequences. We want to maximize the score

More information

Algorithmic Approaches for Biological Data, Lecture #20

Algorithmic Approaches for Biological Data, Lecture #20 Algorithmic Approaches for Biological Data, Lecture #20 Katherine St. John City University of New York American Museum of Natural History 20 April 2016 Outline Aligning with Gaps and Substitution Matrices

More information

Sequence analysis Pairwise sequence alignment

Sequence analysis Pairwise sequence alignment UMF11 Introduction to bioinformatics, 25 Sequence analysis Pairwise sequence alignment 1. Sequence alignment Lecturer: Marina lexandersson 12 September, 25 here are two types of sequence alignments, global

More information

Pairwise Sequence Alignment: Dynamic Programming Algorithms. COMP Spring 2015 Luay Nakhleh, Rice University

Pairwise Sequence Alignment: Dynamic Programming Algorithms. COMP Spring 2015 Luay Nakhleh, Rice University Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 - Spring 2015 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment The number of all possible pairwise alignments (if

More information

Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University

Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University 1 Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment 2 The number of all possible pairwise alignments (if gaps are allowed)

More information

Computational Genomics and Molecular Biology, Fall

Computational Genomics and Molecular Biology, Fall Computational Genomics and Molecular Biology, Fall 2015 1 Sequence Alignment Dannie Durand Pairwise Sequence Alignment The goal of pairwise sequence alignment is to establish a correspondence between the

More information

Sequence Alignment. part 2

Sequence Alignment. part 2 Sequence Alignment part 2 Dynamic programming with more realistic scoring scheme Using the same initial sequences, we ll look at a dynamic programming example with a scoring scheme that selects for matches

More information

Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it.

Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it. Sequence Alignments Overview Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it. Sequence alignment means arranging

More information

Lecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:

Lecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations: Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating

More information

Brief review from last class

Brief review from last class Sequence Alignment Brief review from last class DNA is has direction, we will use only one (5 -> 3 ) and generate the opposite strand as needed. DNA is a 3D object (see lecture 1) but we will model it

More information

Sequence Alignment & Search

Sequence Alignment & Search Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version

More information

BLAST & Genome assembly

BLAST & Genome assembly BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies May 15, 2014 1 BLAST What is BLAST? The algorithm 2 Genome assembly De novo assembly Mapping assembly 3

More information

Notes on Dynamic-Programming Sequence Alignment

Notes on Dynamic-Programming Sequence Alignment Notes on Dynamic-Programming Sequence Alignment Introduction. Following its introduction by Needleman and Wunsch (1970), dynamic programming has become the method of choice for rigorous alignment of DNA

More information

Alignment of Long Sequences

Alignment of Long Sequences Alignment of Long Sequences BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2009 Mark Craven craven@biostat.wisc.edu Pairwise Whole Genome Alignment: Task Definition Given a pair of genomes (or other large-scale

More information

COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1. Database Searching

COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1. Database Searching COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1 Database Searching In database search, we typically have a large sequence database

More information

Outline. Sequence Alignment. Types of Sequence Alignment. Genomics & Computational Biology. Section 2. How Computers Store Information

Outline. Sequence Alignment. Types of Sequence Alignment. Genomics & Computational Biology. Section 2. How Computers Store Information enomics & omputational Biology Section Lan Zhang Sep. th, Outline How omputers Store Information Sequence lignment Dot Matrix nalysis Dynamic programming lobal: NeedlemanWunsch lgorithm Local: SmithWaterman

More information

BLAST & Genome assembly

BLAST & Genome assembly BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies November 17, 2012 1 Introduction Introduction 2 BLAST What is BLAST? The algorithm 3 Genome assembly De

More information

Bioinformatics explained: Smith-Waterman

Bioinformatics explained: Smith-Waterman Bioinformatics Explained Bioinformatics explained: Smith-Waterman May 1, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com

More information

CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment

CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features

More information

Pairwise Sequence Alignment. Zhongming Zhao, PhD

Pairwise Sequence Alignment. Zhongming Zhao, PhD Pairwise Sequence Alignment Zhongming Zhao, PhD Email: zhongming.zhao@vanderbilt.edu http://bioinfo.mc.vanderbilt.edu/ Sequence Similarity match mismatch A T T A C G C G T A C C A T A T T A T G C G A T

More information

BGGN 213 Foundations of Bioinformatics Barry Grant

BGGN 213 Foundations of Bioinformatics Barry Grant BGGN 213 Foundations of Bioinformatics Barry Grant http://thegrantlab.org/bggn213 Recap From Last Time: 25 Responses: https://tinyurl.com/bggn213-02-f17 Why ALIGNMENT FOUNDATIONS Why compare biological

More information

OPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT

OPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT OPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT Asif Ali Khan*, Laiq Hassan*, Salim Ullah* ABSTRACT: In bioinformatics, sequence alignment is a common and insistent task. Biologists align

More information

Today s Lecture. Edit graph & alignment algorithms. Local vs global Computational complexity of pairwise alignment Multiple sequence alignment

Today s Lecture. Edit graph & alignment algorithms. Local vs global Computational complexity of pairwise alignment Multiple sequence alignment Today s Lecture Edit graph & alignment algorithms Smith-Waterman algorithm Needleman-Wunsch algorithm Local vs global Computational complexity of pairwise alignment Multiple sequence alignment 1 Sequence

More information

Principles of Bioinformatics. BIO540/STA569/CSI660 Fall 2010

Principles of Bioinformatics. BIO540/STA569/CSI660 Fall 2010 Principles of Bioinformatics BIO540/STA569/CSI660 Fall 2010 Lecture 11 Multiple Sequence Alignment I Administrivia Administrivia The midterm examination will be Monday, October 18 th, in class. Closed

More information

BLAST MCDB 187. Friday, February 8, 13

BLAST MCDB 187. Friday, February 8, 13 BLAST MCDB 187 BLAST Basic Local Alignment Sequence Tool Uses shortcut to compute alignments of a sequence against a database very quickly Typically takes about a minute to align a sequence against a database

More information

Distributed Protein Sequence Alignment

Distributed Protein Sequence Alignment Distributed Protein Sequence Alignment ABSTRACT J. Michael Meehan meehan@wwu.edu James Hearne hearne@wwu.edu Given the explosive growth of biological sequence databases and the computational complexity

More information

In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace.

In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace. 5 Multiple Match Refinement and T-Coffee In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace. This exposition

More information

An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST

An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise

More information

Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.

Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the

More information

A CAM(Content Addressable Memory)-based architecture for molecular sequence matching

A CAM(Content Addressable Memory)-based architecture for molecular sequence matching A CAM(Content Addressable Memory)-based architecture for molecular sequence matching P.K. Lala 1 and J.P. Parkerson 2 1 Department Electrical Engineering, Texas A&M University, Texarkana, Texas, USA 2

More information

Programming assignment for the course Sequence Analysis (2006)

Programming assignment for the course Sequence Analysis (2006) Programming assignment for the course Sequence Analysis (2006) Original text by John W. Romein, adapted by Bart van Houte (bart@cs.vu.nl) Introduction Please note: This assignment is only obligatory for

More information

24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:

24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading: 24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid

More information

Pairwise alignment II

Pairwise alignment II Pairwise alignment II Agenda - Previous Lesson: Minhala + Introduction - Review Dynamic Programming - Pariwise Alignment Biological Motivation Today: - Quick Review: Sequence Alignment (Global, Local,

More information

Pairwise Sequence alignment Basic Algorithms

Pairwise Sequence alignment Basic Algorithms Pairwise Sequence alignment Basic Algorithms Agenda - Previous Lesson: Minhala - + Biological Story on Biomolecular Sequences - + General Overview of Problems in Computational Biology - Reminder: Dynamic

More information

BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences

BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences Reading in text (Mount Bioinformatics): I must confess that the treatment in Mount of sequence alignment does not seem to me a model

More information

Lecture 3: February Local Alignment: The Smith-Waterman Algorithm

Lecture 3: February Local Alignment: The Smith-Waterman Algorithm CSCI1820: Sequence Alignment Spring 2017 Lecture 3: February 7 Lecturer: Sorin Istrail Scribe: Pranavan Chanthrakumar Note: LaTeX template courtesy of UC Berkeley EECS dept. Notes are also adapted from

More information

BMI/CS 576 Fall 2015 Midterm Exam

BMI/CS 576 Fall 2015 Midterm Exam BMI/CS 576 Fall 2015 Midterm Exam Prof. Colin Dewey Tuesday, October 27th, 2015 11:00am-12:15pm Name: KEY Write your answers on these pages and show your work. You may use the back sides of pages as necessary.

More information

Biochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA)

Biochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA) Biochemistry 324 Bioinformatics Multiple Sequence Alignment (MSA) Big- Οh notation Greek omicron symbol Ο The Big-Oh notation indicates the complexity of an algorithm in terms of execution speed and storage

More information

CMSC423: Bioinformatic Algorithms, Databases and Tools Lecture 8. Note

CMSC423: Bioinformatic Algorithms, Databases and Tools Lecture 8. Note MS: Bioinformatic lgorithms, Databases and ools Lecture 8 Sequence alignment: inexact alignment dynamic programming, gapped alignment Note Lecture 7 suffix trees and suffix arrays will be rescheduled Exact

More information

Darwin-WGA. A Co-processor Provides Increased Sensitivity in Whole Genome Alignments with High Speedup

Darwin-WGA. A Co-processor Provides Increased Sensitivity in Whole Genome Alignments with High Speedup Darwin-WGA A Co-processor Provides Increased Sensitivity in Whole Genome Alignments with High Speedup Yatish Turakhia*, Sneha D. Goenka*, Prof. Gill Bejerano, Prof. William J. Dally * Equal contribution

More information

CS313 Exercise 4 Cover Page Fall 2017

CS313 Exercise 4 Cover Page Fall 2017 CS313 Exercise 4 Cover Page Fall 2017 Due by the start of class on Thursday, October 12, 2017. Name(s): In the TIME column, please estimate the time you spent on the parts of this exercise. Please try

More information

FASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm.

FASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm. FASTA INTRODUCTION Definition (by David J. Lipman and William R. Pearson in 1985) - Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence

More information

Computational Biology Lecture 4: Overlap detection, Local Alignment, Space Efficient Needleman-Wunsch Saad Mneimneh

Computational Biology Lecture 4: Overlap detection, Local Alignment, Space Efficient Needleman-Wunsch Saad Mneimneh Computational Biology Lecture 4: Overlap detection, Local Alignment, Space Efficient Needleman-Wunsch Saad Mneimneh Overlap detection: Semi-Global Alignment An overlap of two sequences is considered an

More information

Dynamic Programming & Smith-Waterman algorithm

Dynamic Programming & Smith-Waterman algorithm m m Seminar: Classical Papers in Bioinformatics May 3rd, 2010 m m 1 2 3 m m Introduction m Definition is a method of solving problems by breaking them down into simpler steps problem need to contain overlapping

More information

BLAST, Profile, and PSI-BLAST

BLAST, Profile, and PSI-BLAST BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources

More information

Accelerating Smith Waterman (SW) Algorithm on Altera Cyclone II Field Programmable Gate Array

Accelerating Smith Waterman (SW) Algorithm on Altera Cyclone II Field Programmable Gate Array Accelerating Smith Waterman (SW) Algorithm on Altera yclone II Field Programmable Gate Array NUR DALILAH AHMAD SABRI, NUR FARAH AIN SALIMAN, SYED ABDUL MUALIB AL JUNID, ABDUL KARIMI HALIM Faculty Electrical

More information

BLAST - Basic Local Alignment Search Tool

BLAST - Basic Local Alignment Search Tool Lecture for ic Bioinformatics (DD2450) April 11, 2013 Searching 1. Input: Query Sequence 2. Database of sequences 3. Subject Sequence(s) 4. Output: High Segment Pairs (HSPs) Sequence Similarity Measures:

More information

.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar..

.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. .. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. PAM and BLOSUM Matrices Prepared by: Jason Banich and Chris Hoover Background As DNA sequences change and evolve, certain amino acids are more

More information

Today s Lecture. Multiple sequence alignment. Improved scoring of pairwise alignments. Affine gap penalties Profiles

Today s Lecture. Multiple sequence alignment. Improved scoring of pairwise alignments. Affine gap penalties Profiles Today s Lecture Multiple sequence alignment Improved scoring of pairwise alignments Affine gap penalties Profiles 1 The Edit Graph for a Pair of Sequences G A C G T T G A A T G A C C C A C A T G A C G

More information

From Smith-Waterman to BLAST

From Smith-Waterman to BLAST From Smith-Waterman to BLAST Jeremy Buhler July 23, 2015 Smith-Waterman is the fundamental tool that we use to decide how similar two sequences are. Isn t that all that BLAST does? In principle, it is

More information

Darwin: A Genomic Co-processor gives up to 15,000X speedup on long read assembly (To appear in ASPLOS 2018)

Darwin: A Genomic Co-processor gives up to 15,000X speedup on long read assembly (To appear in ASPLOS 2018) Darwin: A Genomic Co-processor gives up to 15,000X speedup on long read assembly (To appear in ASPLOS 2018) Yatish Turakhia EE PhD candidate Stanford University Prof. Bill Dally (Electrical Engineering

More information

Alignment and clustering tools for sequence analysis. Omar Abudayyeh Presentation December 9, 2015

Alignment and clustering tools for sequence analysis. Omar Abudayyeh Presentation December 9, 2015 Alignment and clustering tools for sequence analysis Omar Abudayyeh 18.337 Presentation December 9, 2015 Introduction Sequence comparison is critical for inferring biological relationships within large

More information

Sequence alignment theory and applications Session 3: BLAST algorithm

Sequence alignment theory and applications Session 3: BLAST algorithm Sequence alignment theory and applications Session 3: BLAST algorithm Introduction to Bioinformatics online course : IBT Sonal Henson Learning Objectives Understand the principles of the BLAST algorithm

More information

Bioinformatics for Biologists

Bioinformatics for Biologists Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover

More information

Mouse, Human, Chimpanzee

Mouse, Human, Chimpanzee More Alignments 1 Mouse, Human, Chimpanzee Mouse to Human Chimpanzee to Human 2 Mouse v.s. Human Chromosome X of Mouse to Human 3 Local Alignment Given: two sequences S and T Find: substrings of S and

More information

Scalable Accelerator Architecture for Local Alignment of DNA Sequences

Scalable Accelerator Architecture for Local Alignment of DNA Sequences Scalable Accelerator Architecture for Local Alignment of DNA Sequences Nuno Sebastião, Nuno Roma, Paulo Flores INESC-ID / IST-TU Lisbon Rua Alves Redol, 9, Lisboa PORTUGAL {Nuno.Sebastiao, Nuno.Roma, Paulo.Flores}

More information

Genomic Finishing & Consed

Genomic Finishing & Consed Genomic Finishing & Consed SEA stages of genomic analysis Draft vs Finished Draft Sequence Single sequencing approach Limited human intervention Cheap, Fast Finished sequence Multiple approaches Human

More information

Alignment ABC. Most slides are modified from Serafim s lectures

Alignment ABC. Most slides are modified from Serafim s lectures Alignment ABC Most slides are modified from Serafim s lectures Complete genomes Evolution Evolution at the DNA level C ACGGTGCAGTCACCA ACGTTGCAGTCCACCA SEQUENCE EDITS REARRANGEMENTS Sequence conservation

More information

BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha

BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio. 1990. CS 466 Saurabh Sinha Motivation Sequence homology to a known protein suggest function of newly sequenced protein Bioinformatics

More information

Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD

Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Assumptions: Biological sequences evolved by evolution. Micro scale changes: For short sequences (e.g. one

More information

Multiple Sequence Alignment. Mark Whitsitt - NCSA

Multiple Sequence Alignment. Mark Whitsitt - NCSA Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV

More information

BLAST. NCBI BLAST Basic Local Alignment Search Tool

BLAST. NCBI BLAST Basic Local Alignment Search Tool BLAST NCBI BLAST Basic Local Alignment Search Tool http://www.ncbi.nlm.nih.gov/blast/ Global versus local alignments Global alignments: Attempt to align every residue in every sequence, Most useful when

More information

Profiles and Multiple Alignments. COMP 571 Luay Nakhleh, Rice University

Profiles and Multiple Alignments. COMP 571 Luay Nakhleh, Rice University Profiles and Multiple Alignments COMP 571 Luay Nakhleh, Rice University Outline Profiles and sequence logos Profile hidden Markov models Aligning profiles Multiple sequence alignment by gradual sequence

More information

B L A S T! BLAST: Basic local alignment search tool. Copyright notice. February 6, Pairwise alignment: key points. Outline of tonight s lecture

B L A S T! BLAST: Basic local alignment search tool. Copyright notice. February 6, Pairwise alignment: key points. Outline of tonight s lecture February 6, 2008 BLAST: Basic local alignment search tool B L A S T! Jonathan Pevsner, Ph.D. Introduction to Bioinformatics pevsner@jhmi.edu 4.633.0 Copyright notice Many of the images in this powerpoint

More information

Basic Local Alignment Search Tool (BLAST)

Basic Local Alignment Search Tool (BLAST) BLAST 26.04.2018 Basic Local Alignment Search Tool (BLAST) BLAST (Altshul-1990) is an heuristic Pairwise Alignment composed by six-steps that search for local similarities. The most used access point to

More information

BIOINFORMATICS A PRACTICAL GUIDE TO THE ANALYSIS OF GENES AND PROTEINS

BIOINFORMATICS A PRACTICAL GUIDE TO THE ANALYSIS OF GENES AND PROTEINS BIOINFORMATICS A PRACTICAL GUIDE TO THE ANALYSIS OF GENES AND PROTEINS EDITED BY Genome Technology Branch National Human Genome Research Institute National Institutes of Health Bethesda, Maryland B. F.

More information

FastA & the chaining problem

FastA & the chaining problem FastA & the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 1 Sources for this lecture: Lectures by Volker Heun, Daniel Huson and Knut Reinert,

More information

Algorithms and Tools for Bioinformatics on GPUs. Bertil SCHMIDT

Algorithms and Tools for Bioinformatics on GPUs. Bertil SCHMIDT Algorithms and Tools for Bioinformatics on GPUs Bertil SCHMIDT Contents Motivation Pairwise Sequence Alignment Multiple Sequence Alignment Short Read Error Correction using CUDA Some other CUDA-enabled

More information

FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:

FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10: FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:56 4001 4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem

More information

Sequence alignment algorithms

Sequence alignment algorithms Sequence alignment algorithms Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 23 rd 27 After this lecture, you can decide when to use local and global sequence alignments

More information

Computational Molecular Biology

Computational Molecular Biology Computational Molecular Biology Erwin M. Bakker Lecture 2 Materials used from R. Shamir [2] and H.J. Hoogeboom [4]. 1 Molecular Biology Sequences DNA A, T, C, G RNA A, U, C, G Protein A, R, D, N, C E,

More information

TCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology?

TCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology? Local Sequence Alignment & Heuristic Local Aligners Lectures 18 Nov 28, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall

More information

Similarity Searches on Sequence Databases

Similarity Searches on Sequence Databases Similarity Searches on Sequence Databases Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Zürich, October 2004 Swiss Institute of Bioinformatics Swiss EMBnet node Outline Importance of

More information

Computational Molecular Biology

Computational Molecular Biology Computational Molecular Biology Erwin M. Bakker Lecture 3, mainly from material by R. Shamir [2] and H.J. Hoogeboom [4]. 1 Pairwise Sequence Alignment Biological Motivation Algorithmic Aspect Recursive

More information

Sequencing Alignment I

Sequencing Alignment I Sequencing Alignment I Lectures 16 Nov 21, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall (JHN) 022 1 Outline: Sequence

More information

Jyoti Lakhani 1, Ajay Khunteta 2, Dharmesh Harwani *3 1 Poornima University, Jaipur & Maharaja Ganga Singh University, Bikaner, Rajasthan, India

Jyoti Lakhani 1, Ajay Khunteta 2, Dharmesh Harwani *3 1 Poornima University, Jaipur & Maharaja Ganga Singh University, Bikaner, Rajasthan, India International Journal of Scientific Research in Computer Science, Engineering and Information Technology 2017 IJSRCSEIT Volume 2 Issue 6 ISSN : 2456-3307 Improvisation of Global Pairwise Sequence Alignment

More information

Dynamic Programming Part I: Examples. Bioinfo I (Institut Pasteur de Montevideo) Dynamic Programming -class4- July 25th, / 77

Dynamic Programming Part I: Examples. Bioinfo I (Institut Pasteur de Montevideo) Dynamic Programming -class4- July 25th, / 77 Dynamic Programming Part I: Examples Bioinfo I (Institut Pasteur de Montevideo) Dynamic Programming -class4- July 25th, 2011 1 / 77 Dynamic Programming Recall: the Change Problem Other problems: Manhattan

More information

Keywords -Bioinformatics, sequence alignment, Smith- waterman (SW) algorithm, GPU, CUDA

Keywords -Bioinformatics, sequence alignment, Smith- waterman (SW) algorithm, GPU, CUDA Volume 5, Issue 5, May 2015 ISSN: 2277 128X International Journal of Advanced Research in Computer Science and Software Engineering Research Paper Available online at: www.ijarcsse.com Accelerating Smith-Waterman

More information

Read Mapping. Slides by Carl Kingsford

Read Mapping. Slides by Carl Kingsford Read Mapping Slides by Carl Kingsford Bowtie Ultrafast and memory-efficient alignment of short DNA sequences to the human genome Ben Langmead, Cole Trapnell, Mihai Pop and Steven L Salzberg, Genome Biology

More information

Similarity searches in biological sequence databases

Similarity searches in biological sequence databases Similarity searches in biological sequence databases Volker Flegel september 2004 Page 1 Outline Keyword search in databases General concept Examples SRS Entrez Expasy Similarity searches in databases

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 04: Variations of sequence alignments http://www.pitt.edu/~mcs2/teaching/biocomp/tutorials/global.html Slides adapted from Dr. Shaojie Zhang (University

More information

A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity

A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity G. Pratyusha, Department of Computer Science & Engineering, V.R.Siddhartha Engineering College(Autonomous)

More information

Sequence Alignment (chapter 6) p The biological problem p Global alignment p Local alignment p Multiple alignment

Sequence Alignment (chapter 6) p The biological problem p Global alignment p Local alignment p Multiple alignment Sequence lignment (chapter 6) p The biological problem p lobal alignment p Local alignment p Multiple alignment Local alignment: rationale p Otherwise dissimilar proteins may have local regions of similarity

More information

Pairwise alignment using shortest path algorithms, Gunnar Klau, November 29, 2005, 11:

Pairwise alignment using shortest path algorithms, Gunnar Klau, November 29, 2005, 11: airwise alignment using shortest path algorithms, Gunnar Klau, November 9,, : 3 3 airwise alignment using shortest path algorithms e will iscuss: it graph Dijkstra s algorithm algorithm (GDU) 3. References

More information

Acceleration of the Smith-Waterman algorithm for DNA sequence alignment using an FPGA platform

Acceleration of the Smith-Waterman algorithm for DNA sequence alignment using an FPGA platform Acceleration of the Smith-Waterman algorithm for DNA sequence alignment using an FPGA platform Barry Strengholt Matthijs Brobbel Delft University of Technology Faculty of Electrical Engineering, Mathematics

More information

A Design of a Hybrid System for DNA Sequence Alignment

A Design of a Hybrid System for DNA Sequence Alignment IMECS 2008, 9-2 March, 2008, Hong Kong A Design of a Hybrid System for DNA Sequence Alignment Heba Khaled, Hossam M. Faheem, Tayseer Hasan, Saeed Ghoneimy Abstract This paper describes a parallel algorithm

More information

Basics of Multiple Sequence Alignment

Basics of Multiple Sequence Alignment Basics of Multiple Sequence Alignment Tandy Warnow February 10, 2018 Basics of Multiple Sequence Alignment Tandy Warnow Basic issues What is a multiple sequence alignment? Evolutionary processes operating

More information

Central Issues in Biological Sequence Comparison

Central Issues in Biological Sequence Comparison Central Issues in Biological Sequence Comparison Definitions: What is one trying to find or optimize? Algorithms: Can one find the proposed object optimally or in reasonable time optimize? Statistics:

More information

Multiple Sequence Alignment Sum-of-Pairs and ClustalW. Ulf Leser

Multiple Sequence Alignment Sum-of-Pairs and ClustalW. Ulf Leser Multiple Sequence Alignment Sum-of-Pairs and ClustalW Ulf Leser This Lecture Multiple Sequence Alignment The problem Theoretical approach: Sum-of-Pairs scores Practical approach: ClustalW Ulf Leser: Bioinformatics,

More information

Lectures by Volker Heun, Daniel Huson and Knut Reinert, in particular last years lectures

Lectures by Volker Heun, Daniel Huson and Knut Reinert, in particular last years lectures 4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 4.1 Sources for this lecture Lectures by Volker Heun, Daniel Huson and Knut

More information

Multiple Sequence Alignment Augmented by Expert User Constraints

Multiple Sequence Alignment Augmented by Expert User Constraints Multiple Sequence Alignment Augmented by Expert User Constraints A Thesis Submitted to the College of Graduate Studies and Research in Partial Fulfillment of the Requirements for the degree of Master of

More information

Tour Guide for Windows and Macintosh

Tour Guide for Windows and Macintosh Tour Guide for Windows and Macintosh 2011 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Suite 100A, Ann Arbor, MI 48108 USA phone 1.800.497.4939 or 1.734.769.7249 (fax) 1.734.769.7074

More information

Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion.

Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. www.ijarcet.org 54 Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. Hassan Kehinde Bello and Kazeem Alagbe Gbolagade Abstract Biological sequence alignment is becoming popular

More information

Under the Hood of Alignment Algorithms for NGS Researchers

Under the Hood of Alignment Algorithms for NGS Researchers Under the Hood of Alignment Algorithms for NGS Researchers April 16, 2014 Gabe Rudy VP of Product Development Golden Helix Questions during the presentation Use the Questions pane in your GoToWebinar window

More information

Problem Paper Atoms Tree. atoms.pas. atoms.cpp. atoms.c. atoms.java. Time limit per test 1 second 1 second 2 seconds. Number of tests

Problem Paper Atoms Tree. atoms.pas. atoms.cpp. atoms.c. atoms.java. Time limit per test 1 second 1 second 2 seconds. Number of tests ! " # %$ & Overview Problem Paper Atoms Tree Shen Tian Harry Wiggins Carl Hultquist Program name paper.exe atoms.exe tree.exe Source name paper.pas atoms.pas tree.pas paper.cpp atoms.cpp tree.cpp paper.c

More information

Database Searching Using BLAST

Database Searching Using BLAST Mahidol University Objectives SCMI512 Molecular Sequence Analysis Database Searching Using BLAST Lecture 2B After class, students should be able to: explain the FASTA algorithm for database searching explain

More information

Quiz section 10. June 1, 2018

Quiz section 10. June 1, 2018 Quiz section 10 June 1, 2018 Logistics Bring: 1 page cheat-sheet, simple calculator Any last logistics questions about the final? Logistics Bring: 1 page cheat-sheet, simple calculator Any last logistics

More information