15-780: Graduate Artificial Intelligence. Computational biology: Sequence alignment and profile HMMs
|
|
- MargaretMargaret Todd
- 5 years ago
- Views:
Transcription
1 5-78: Graduate rtificial Intelligence omputational biology: Sequence alignment and profile HMMs
2 entral dogma DN GGGG transcription mrn UGGUUUGUG translation Protein PEPIDE 2
3 omparison of Different Organisms Genome size Num. of genes E. coli Yeast Worm.5* 8.5* 8 * 8 4,2 6, 8,4 Fly.8* 8 3,6 Human 3* 8 25, Plant.3* 8 25, 3
4 ssigning function to proteins One of the main goals of molecular (and computational) biology. here are 25 human genes and the vast majority of their functions is still unknown Several ways to determine function - Direct experiments (knockout, overexpression) - Interacting partners - 3D structures - Sequence homology Hard Easier 4
5 Function from sequence homology We have a query gene: GGGG Given a database containing genes with known function, our goal is to find similar genes from this database (possibly in another organism) When we find such gene we predict the function of the query gene to be similar to the resulting database gene Problems - How do we determine similarity? 5
6 Sequence analysis techniques major area of research within computational biology. Initially, based on deterministic or heuristic alignment methods More recently, based on probabilistic inference methods 6
7 Sequence analysis raditional - Dynamic programming - Blast Probabilsitic - Profile HMMs 7
8 Pairwise sequence alignment G G G G G G 8
9 Pairwise sequence alignment G G G G We cannot expect the alignments to be perfect. Major reasons include insertion, deletion and substitutions. We need to allow gaps in the resulting alignment. G G 9
10 Scoring lignments lignments can be scored by comparing the resulting alignment to a background (random) model. Independent Related P ( x, y I ) =! q i x i! j q x j P ( x, y M ) =! i p x i y i Score for alignment: S s( x i, y i ) =! i where: s ( a, b) = pa, log( q q a b b )
11 P ( x, y I ) Scoring lignments lignments can be scored by comparing the resulting alignment to a background (random) model. In other Independent words, we are trying to find Related an alignment that maximizes the likelihood ratio of the aligned pair compared to the background model q P ( x, y M ) p =! q i x i! j x j =! i x i y i Score for alignment: S s( x i, y i ) =! i where: s ( a, b) = pa, log( q q a b b )
12 omputing optimal alignment: he Needham-Wuncsh algorithm F(i,j)+s(x i,x j ) F(i,j) = max F(i,j)+d F(i,j)+d d is a penalty for a gap G F(i,j) F(i,j) F(i,j) F(i,j) 2
13 Example ssume a simple model where S(a,b) = if a=b and -5 otherwise. lso, assume that d = G
14 Example ssume a simple model where S(a,b) = if a=b and -5 otherwise. lso, assume that d = G F(i,j)+s(x i,x j ) -5-6 F(i,j) = max F(i,j)+d F(i,j)+d
15 Example ssume a simple model where S(a,b) = if a=b and -5 otherwise. lso, assume that d = G F(i,j)+s(x i,x j ) -5-6 F(i,j) = max F(i,j)+d F(i,j)+d
16 Example ssume a simple model where S(a,b) = if a=b and -5 otherwise. lso, assume that d = G F(i,j)+s(x i,x j ) -5-6 F(i,j) = max F(i,j)+d F(i,j)+d
17 Example ssume a simple model where S(a,b) = if a=b and -5 otherwise. lso, assume that d = G
18 Example ssume a simple model where S(a,b) = if a=b and -5 otherwise. lso, assume that d = G
19 Example ssume a simple model where S(a,b) = if a=b and -5 otherwise. lso, assume that d = G G
20 Running time he running time of an alignment algorithms if O(n 2 ) his doesn t sound too bad, or is it? he time requirement for doing global sequence alignment is too high in many cases. onsider a database with tens of thousands of sequences. Looking through all these sequences for the best alignment is too time consuming. In many cases, a much faster heuristic approach can achieve equally good results. 2
21 BLS: Basic Local lignment Search ool Heuristic alignment method, first presented in 99. he biggest success of computational biology to date. Since it was suggested, a number of new and improved version where presented (psi-bls). urrently available with almost all public databases. 2
22 BLS (cont.) Sequence is composed of a list of words. Uses a dictionary (3 for and for nucleotides). ll matches to database are recorded. 22
23 BLS Hits are extended in both direction if they are less than X bases away from each other. ll sequences reaching a certain score are returned, and a complete alignment is performed. 23
24 24
25 Sequence analysis raditional - Dynamic programming - Blast Probabilsitic - Profile HMMs 25
26 Protein families Proteins can be classified into families (and further into sub families etc.) specific family includes proteins with similar high level functions For example: - ranscription factors - Receptors - Etc. Family assignment is an important first step towards function prediction 26
27 Multiple lignment Process Process of aligning three or more sequences with each other Fine for offline computations We can determine such alignment by generalizing the algorithm to align two sequences What s the complexity of this? 27
28 Multiple lignment: Reasons for differences Substitutions Insertions Deletions 28
29 Biological Motivation: Given a single amino acid target sequence of unknown protein we want to infer the family of the resulting protein. 29
30 Methods for haracterizing a Protein Family Objective: Given a number of related sequences, encapsulate what they have in common in such a way that we can recognize other members of the family. Some standard methods for characterization: Multiple lignments Regular Expressions onsensus Sequences Hidden Markov Models 3
31 Designing HMMs: onsensus (match) states We first include states to output the consensus sequence :.8 :.8 :.8 :.8 :.2 G:.2 :.2 G:.2 3
32 Designing HMMs: Insertions We next add states to allow insertions start.4 :.2 :.4 : G:.2 : :.8 :.8 :.8.4 :.8 :.2 G:.2 :.2 G:.2 32
33 Designing HMMs: Deletions Finally we add states with no output to allow for deletions start O O O.4 :.2 :.4 : G:.2 : :.8 :.8 :.8.4 :.8 :.2 G:.2 :.2 G:.2 33
34 Scoring our simple HMM # - G G G vrs: #2 - HMM: # = Score of -.97 #2 Score of 6.7 (Log odds) 34
35 ligning and raining HMMs raining from a Multiple lignment raining from unaligned sequences ligning a sequence to a model an be used to create an alignment an be used to score a sequence an be used to interpret a sequence 35
36 raining from an existing alignment Start with a predetermined number of states in your HMM. For each position in the model, assign a MLE column in the multiple alignment that is estimates relatively conserved. Emission probabilities are set according to amino acid counts in columns. ransition probabilities are set according to how many sequences make use of a given delete or insert state. 36
37 Remember the simple example hose six positions in model. Highlighted area was selected to be modeled by an insert due to variability. an also do neat tricks for picking length of model, such as model pruning. 37
38 ligning sequences to a model Now that we have a profile model, let s use it! ompute the likelihood of the best set of states for this sequence We know how to do this: he Viterbi algortthm ime: O(N*M) 38
39 So what do we do with an alignment to a model? Design statistical tests to determine how likely it is to get this score from a random (gene) sequence Use several protein family models for classifying new proteins, assign protein to most highly scoring family. 39
40 raining from unaligned Baum-Welch algorithm sequences Start with a model whose length matches the average length of the sequences and with random emission and transition probabilities. lign all the sequences to the model. Use the alignment to alter the emission and transition probabilities Repeat. ontinue until the model stops changing By-product: It produces a multiple alignment 4
41 raining from unaligned continued dvantages: You take full advantage of the expressiveness of your HMM. You might not have a multiple alignment on hand. Disadvantages: HMM training methods are local optimizers, you may not get the best alignment or the best model unless you re very careful. an be alleviated by starting from a logical model instead of a random one. 4
42 Profile HMM Effectiveness Overview dvantages: Very expressive profiling method ransparent method: You can view and interpret the model produced Very effective at detecting remote homologs Disadvantages: Slow full search on a database of 4, sequences can take 5 hours Have to avoid over-fitting and locally optimal models 42
43 Limitations Markov hains Probabilities of states are supposed to be independent P(x) P(y) P(y) must be independent of P(x), and vice versa his usually isn t true 43
44 Protein Structure 44
45 Summary Initial methods for sequence alignment relied on combinatorial and dynamic programming methods. hese methods do not generalize well for multiple sequence alignment and for searching large databases. State of the art methods rely on I techniques, primarily variants of HMMs to overcome this problem. 45
46 46
Machine Learning. Computational biology: Sequence alignment and profile HMMs
10-601 Machine Learning Computational biology: Sequence alignment and profile HMMs Central dogma DNA CCTGAGCCAACTATTGATGAA transcription mrna CCUGAGCCAACUAUUGAUGAA translation Protein PEPTIDE 2 Growth
More informationProfiles and Multiple Alignments. COMP 571 Luay Nakhleh, Rice University
Profiles and Multiple Alignments COMP 571 Luay Nakhleh, Rice University Outline Profiles and sequence logos Profile hidden Markov models Aligning profiles Multiple sequence alignment by gradual sequence
More informationHIDDEN MARKOV MODELS AND SEQUENCE ALIGNMENT
HIDDEN MARKOV MODELS AND SEQUENCE ALIGNMENT - Swarbhanu Chatterjee. Hidden Markov models are a sophisticated and flexible statistical tool for the study of protein models. Using HMMs to analyze proteins
More informationBiology 644: Bioinformatics
A statistical Markov model in which the system being modeled is assumed to be a Markov process with unobserved (hidden) states in the training data. First used in speech and handwriting recognition In
More informationCS313 Exercise 4 Cover Page Fall 2017
CS313 Exercise 4 Cover Page Fall 2017 Due by the start of class on Thursday, October 12, 2017. Name(s): In the TIME column, please estimate the time you spent on the parts of this exercise. Please try
More information!"#$ Gribskov Profile. Hidden Markov Models. Building an Hidden Markov Model. Proteins, DNA and other genomic features can be
Gribskov Profile $ Hidden Markov Models Building an Hidden Markov Model $ Proteins, DN and other genomic features can be classified into families of related sequences and structures $ Related sequences
More informationBLAST, Profile, and PSI-BLAST
BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources
More informationGribskov Profile. Hidden Markov Models. Building a Hidden Markov Model #$ %&
Gribskov Profile #$ %& Hidden Markov Models Building a Hidden Markov Model "! Proteins, DNA and other genomic features can be classified into families of related sequences and structures How to detect
More informationComputational Molecular Biology
Computational Molecular Biology Erwin M. Bakker Lecture 3, mainly from material by R. Shamir [2] and H.J. Hoogeboom [4]. 1 Pairwise Sequence Alignment Biological Motivation Algorithmic Aspect Recursive
More informationPROTEIN MULTIPLE ALIGNMENT MOTIVATION: BACKGROUND: Marina Sirota
Marina Sirota MOTIVATION: PROTEIN MULTIPLE ALIGNMENT To study evolution on the genetic level across a wide range of organisms, biologists need accurate tools for multiple sequence alignment of protein
More informationSequence analysis Pairwise sequence alignment
UMF11 Introduction to bioinformatics, 25 Sequence analysis Pairwise sequence alignment 1. Sequence alignment Lecturer: Marina lexandersson 12 September, 25 here are two types of sequence alignments, global
More informationChapter 6. Multiple sequence alignment (week 10)
Course organization Introduction ( Week 1,2) Part I: Algorithms for Sequence Analysis (Week 1-11) Chapter 1-3, Models and theories» Probability theory and Statistics (Week 3)» Algorithm complexity analysis
More information24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:
24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid
More informationBasic Local Alignment Search Tool (BLAST)
BLAST 26.04.2018 Basic Local Alignment Search Tool (BLAST) BLAST (Altshul-1990) is an heuristic Pairwise Alignment composed by six-steps that search for local similarities. The most used access point to
More informationMultiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences
Multiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences Yue Lu and Sing-Hoi Sze RECOMB 2007 Presented by: Wanxing Xu March 6, 2008 Content Biology Motivation Computation Problem
More informationCISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Sequence pairwise alignment Score statistics: E-value and p-value Heuristic algorithms: BLAST and FASTA Database search: gene finding and annotations
More informationLecture 5: Markov models
Master s course Bioinformatics Data Analysis and Tools Lecture 5: Markov models Centre for Integrative Bioinformatics Problem in biology Data and patterns are often not clear cut When we want to make a
More informationChapter 8 Multiple sequence alignment. Chaochun Wei Spring 2018
1896 1920 1987 2006 Chapter 8 Multiple sequence alignment Chaochun Wei Spring 2018 Contents 1. Reading materials 2. Multiple sequence alignment basic algorithms and tools how to improve multiple alignment
More informationCISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment
CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features
More informationBLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha
BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio. 1990. CS 466 Saurabh Sinha Motivation Sequence homology to a known protein suggest function of newly sequenced protein Bioinformatics
More informationHeuristic methods for pairwise alignment:
Bi03c_1 Unit 03c: Heuristic methods for pairwise alignment: k-tuple-methods k-tuple-methods for alignment of pairs of sequences Bi03c_2 dynamic programming is too slow for large databases Use heuristic
More informationQuiz Section Week 8 May 17, Machine learning and Support Vector Machines
Quiz Section Week 8 May 17, 2016 Machine learning and Support Vector Machines Another definition of supervised machine learning Given N training examples (objects) {(x 1,y 1 ), (x 2,y 2 ),, (x N,y N )}
More informationSequence alignment theory and applications Session 3: BLAST algorithm
Sequence alignment theory and applications Session 3: BLAST algorithm Introduction to Bioinformatics online course : IBT Sonal Henson Learning Objectives Understand the principles of the BLAST algorithm
More informationBiology 644: Bioinformatics
Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find
More informationStephen Scott.
1 / 33 sscott@cse.unl.edu 2 / 33 Start with a set of sequences In each column, residues are homolgous Residues occupy similar positions in 3D structure Residues diverge from a common ancestral residue
More informationGenome 559. Hidden Markov Models
Genome 559 Hidden Markov Models A simple HMM Eddy, Nat. Biotech, 2004 Notes Probability of a given a state path and output sequence is just product of emission/transition probabilities If state path is
More informationC E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 13 G R A T I V. Iterative homology searching,
C E N T R E F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U Introduction to bioinformatics 2007 Lecture 13 Iterative homology searching, PSI (Position Specific Iterated) BLAST basic idea use
More informationBLAST. Basic Local Alignment Search Tool. Used to quickly compare a protein or DNA sequence to a database.
BLAST Basic Local Alignment Search Tool Used to quickly compare a protein or DNA sequence to a database. There is no such thing as a free lunch BLAST is fast and highly sensitive compared to competitors.
More informationSequence Comparison: Dynamic Programming. Genome 373 Genomic Informatics Elhanan Borenstein
Sequence omparison: Dynamic Programming Genome 373 Genomic Informatics Elhanan Borenstein quick review: hallenges Find the best global alignment of two sequences Find the best global alignment of multiple
More informationOutline. Sequence Alignment. Types of Sequence Alignment. Genomics & Computational Biology. Section 2. How Computers Store Information
enomics & omputational Biology Section Lan Zhang Sep. th, Outline How omputers Store Information Sequence lignment Dot Matrix nalysis Dynamic programming lobal: NeedlemanWunsch lgorithm Local: SmithWaterman
More informationSequence Alignment (chapter 6) p The biological problem p Global alignment p Local alignment p Multiple alignment
Sequence lignment (chapter 6) p The biological problem p lobal alignment p Local alignment p Multiple alignment Local alignment: rationale p Otherwise dissimilar proteins may have local regions of similarity
More informationHMMConverter A tool-box for hidden Markov models with two novel, memory efficient parameter training algorithms
HMMConverter A tool-box for hidden Markov models with two novel, memory efficient parameter training algorithms by TIN YIN LAM B.Sc., The Chinese University of Hong Kong, 2006 A THESIS SUBMITTED IN PARTIAL
More informationICB Fall G4120: Introduction to Computational Biology. Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology
ICB Fall 2008 G4120: Computational Biology Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology Copyright 2008 Oliver Jovanovic, All Rights Reserved. The Digital Language of Computers
More informationDynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014
Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into
More informationGLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment
GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment Scoring Dynamic Programming algorithms Heuristic algorithms CLUSTAL W Courtesy of jalview Motivations Collective (or aggregate) statistic
More informationMultiple Sequence Alignment. Mark Whitsitt - NCSA
Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV
More informationDatabase Searching Using BLAST
Mahidol University Objectives SCMI512 Molecular Sequence Analysis Database Searching Using BLAST Lecture 2B After class, students should be able to: explain the FASTA algorithm for database searching explain
More informationMismatch String Kernels for SVM Protein Classification
Mismatch String Kernels for SVM Protein Classification by C. Leslie, E. Eskin, J. Weston, W.S. Noble Athina Spiliopoulou Morfoula Fragopoulou Ioannis Konstas Outline Definitions & Background Proteins Remote
More informationLecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:
Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating
More informationAlignment of Pairs of Sequences
Bi03a_1 Unit 03a: Alignment of Pairs of Sequences Partners for alignment Bi03a_2 Protein 1 Protein 2 =amino-acid sequences (20 letter alphabeth + gap) LGPSSKQTGKGS-SRIWDN LN-ITKSAGKGAIMRLGDA -------TGKG--------
More informationFinding data. HMMER Answer key
Finding data HMMER Answer key HMMER input is prepared using VectorBase ClustalW, which runs a Java application for the graphical representation of the results. If you get an error message that blocks this
More informationSequence Alignment & Search
Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version
More informationINTRODUCTION TO BIOINFORMATICS
Molecular Biology-2019 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain
More informationBioinformatics explained: Smith-Waterman
Bioinformatics Explained Bioinformatics explained: Smith-Waterman May 1, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com
More informationSequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it.
Sequence Alignments Overview Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it. Sequence alignment means arranging
More informationINTRODUCTION TO BIOINFORMATICS
Molecular Biology-2017 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain
More informationUSING AN EXTENDED SUFFIX TREE TO SPEED-UP SEQUENCE ALIGNMENT
IADIS International Conference Applied Computing 2006 USING AN EXTENDED SUFFIX TREE TO SPEED-UP SEQUENCE ALIGNMENT Divya R. Singh Software Engineer Microsoft Corporation, Redmond, WA 98052, USA Abdullah
More informationNew String Kernels for Biosequence Data
Workshop on Kernel Methods in Bioinformatics New String Kernels for Biosequence Data Christina Leslie Department of Computer Science Columbia University Biological Sequence Classification Problems Protein
More informationUsing Hidden Markov Models to Detect DNA Motifs
San Jose State University SJSU ScholarWorks Master's Projects Master's Theses and Graduate Research Spring 5-13-2015 Using Hidden Markov Models to Detect DNA Motifs Santrupti Nerli San Jose State University
More informationBLAST - Basic Local Alignment Search Tool
Lecture for ic Bioinformatics (DD2450) April 11, 2013 Searching 1. Input: Query Sequence 2. Database of sequences 3. Subject Sequence(s) 4. Output: High Segment Pairs (HSPs) Sequence Similarity Measures:
More informationComputational Genomics and Molecular Biology, Fall
Computational Genomics and Molecular Biology, Fall 2015 1 Sequence Alignment Dannie Durand Pairwise Sequence Alignment The goal of pairwise sequence alignment is to establish a correspondence between the
More informationAs of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be
48 Bioinformatics I, WS 09-10, S. Henz (script by D. Huson) November 26, 2009 4 BLAST and BLAT Outline of the chapter: 1. Heuristics for the pairwise local alignment of two sequences 2. BLAST: search and
More informationBioinformatics explained: BLAST. March 8, 2007
Bioinformatics Explained Bioinformatics explained: BLAST March 8, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com Bioinformatics
More informationCAP BLAST. BIOINFORMATICS Su-Shing Chen CISE. 8/20/2005 Su-Shing Chen, CISE 1
CAP 5510-6 BLAST BIOINFORMATICS Su-Shing Chen CISE 8/20/2005 Su-Shing Chen, CISE 1 BLAST Basic Local Alignment Prof Search Su-Shing Chen Tool A Fast Pair-wise Alignment and Database Searching Tool 8/20/2005
More informationGenome 559: Introduction to Statistical and Computational Genomics. Lecture15a Multiple Sequence Alignment Larry Ruzzo
Genome 559: Introduction to Statistical and Computational Genomics Lecture15a Multiple Sequence Alignment Larry Ruzzo 1 Multiple Alignment: Motivations Common structure, function, or origin may be only
More informationTutorial 4 BLAST Searching the CHO Genome
Tutorial 4 BLAST Searching the CHO Genome Accessing the CHO Genome BLAST Tool The CHO BLAST server can be accessed by clicking on the BLAST button on the home page or by selecting BLAST from the menu bar
More informationUsing Hidden Markov Models for Multiple Sequence Alignments Lab #3 Chem 389 Kelly M. Thayer
Página 1 de 10 Using Hidden Markov Models for Multiple Sequence Alignments Lab #3 Chem 389 Kelly M. Thayer Resources: Bioinformatics, David Mount Ch. 4 Multiple Sequence Alignments http://www.netid.com/index.html
More informationMultiple Sequence Alignment: Multidimensional. Biological Motivation
Multiple Sequence Alignment: Multidimensional Dynamic Programming Boston University Biological Motivation Compare a new sequence with the sequences in a protein family. Proteins can be categorized into
More informationECE521: Week 11, Lecture March 2017: HMM learning/inference. With thanks to Russ Salakhutdinov
ECE521: Week 11, Lecture 20 27 March 2017: HMM learning/inference With thanks to Russ Salakhutdinov Examples of other perspectives Murphy 17.4 End of Russell & Norvig 15.2 (Artificial Intelligence: A Modern
More informationTCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology?
Local Sequence Alignment & Heuristic Local Aligners Lectures 18 Nov 28, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall
More informationBioinformatics. Sequence alignment BLAST Significance. Next time Protein Structure
Bioinformatics Sequence alignment BLAST Significance Next time Protein Structure 1 Experimental origins of sequence data The Sanger dideoxynucleotide method F Each color is one lane of an electrophoresis
More informationBIOL591: Introduction to Bioinformatics Alignment of pairs of sequences
BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences Reading in text (Mount Bioinformatics): I must confess that the treatment in Mount of sequence alignment does not seem to me a model
More informationMultiple Sequence Alignment II
Multiple Sequence Alignment II Lectures 20 Dec 5, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall (JHN) 022 1 Outline
More informationData Mining Technologies for Bioinformatics Sequences
Data Mining Technologies for Bioinformatics Sequences Deepak Garg Computer Science and Engineering Department Thapar Institute of Engineering & Tecnology, Patiala Abstract Main tool used for sequence alignment
More informationReview: Human-Mouse Dot Plot
Review: Human-Mouse Dot Plot BLAST high level overview Finding runs and extending them (old version) Extend alignments greedily off each end; stop when the score drops below a threshold Alignments are
More informationHidden Markov Models. Mark Voorhies 4/2/2012
4/2/2012 Searching with PSI-BLAST 0 th order Markov Model 1 st order Markov Model 1 st order Markov Model 1 st order Markov Model What are Markov Models good for? Background sequence composition Spam Hidden
More informationAlignments BLAST, BLAT
Alignments BLAST, BLAT Genome Genome Gene vs Built of DNA DNA Describes Organism Protein gene Stored as Circular/ linear Single molecule, or a few of them Both (depending on the species) Part of genome
More informationCOS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1. Database Searching
COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1 Database Searching In database search, we typically have a large sequence database
More informationWilson Leung 05/27/2008 A Simple Introduction to NCBI BLAST
A Simple Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at http://www.ncbi.nih.gov/blast/
More informationIntroduction to BLAST with Protein Sequences. Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2
Introduction to BLAST with Protein Sequences Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2 1 References Chapter 2 of Biological Sequence Analysis (Durbin et al., 2001)
More informationWilson Leung 01/03/2018 An Introduction to NCBI BLAST. Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment
An Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at https://blast.ncbi.nlm.nih.gov/blast.cgi
More informationBrief review from last class
Sequence Alignment Brief review from last class DNA is has direction, we will use only one (5 -> 3 ) and generate the opposite strand as needed. DNA is a 3D object (see lecture 1) but we will model it
More information8/19/13. Computational problems. Introduction to Algorithm
I519, Introduction to Introduction to Algorithm Yuzhen Ye (yye@indiana.edu) School of Informatics and Computing, IUB Computational problems A computational problem specifies an input-output relationship
More informationMULTIPLE SEQUENCE ALIGNMENT SOLUTIONS AND APPLICATIONS
MULTIPLE SEQUENCE ALIGNMENT SOLUTIONS AND APPLICATIONS By XU ZHANG A DISSERTATION PRESENTED TO THE GRADUATE SCHOOL OF THE UNIVERSITY OF FLORIDA IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE
More information3.4 Multiple sequence alignment
3.4 Multiple sequence alignment Why produce a multiple sequence alignment? Using more than two sequences results in a more convincing alignment by revealing conserved regions in ALL of the sequences Aligned
More informationIntroduction to Phylogenetics Week 2. Databases and Sequence Formats
Introduction to Phylogenetics Week 2 Databases and Sequence Formats I. Databases Crucial to bioinformatics The bigger the database, the more comparative research data Requires scientists to upload data
More informationHomology Modeling FABP
Homology Modeling FABP Homology modeling is a technique used to approximate the 3D structure of a protein when no experimentally determined structure exists. It operates under the principle that protein
More informationData Walkthrough: Background
Data Walkthrough: Background File Types FASTA Files FASTA files are text-based representations of genetic information. They can contain nucleotide or amino acid sequences. For this activity, students will
More informationCompares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.
Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the
More informationSoftware Implementation of Smith-Waterman Algorithm in FPGA
Software Implementation of Smith-Waterman lgorithm in FP NUR FRH IN SLIMN, NUR DLILH HMD SBRI, SYED BDUL MULIB L JUNID, ZULKIFLI BD MJID, BDUL KRIMI HLIM Faculty of Electrical Engineering Universiti eknologi
More informationA simple noise model. Algorithm sketch. A simple noise model. Estimating the probabilities
Recap: noisy channel model Foundations of Natural anguage Processing ecture 6 pelling correction, edit distance, and EM lex ascarides (lides from lex ascarides and haron Goldwater) 1 February 2019 general
More informationStructured Learning. Jun Zhu
Structured Learning Jun Zhu Supervised learning Given a set of I.I.D. training samples Learn a prediction function b r a c e Supervised learning (cont d) Many different choices Logistic Regression Maximum
More informationIntroduction to Computational Molecular Biology
18.417 Introduction to Computational Molecular Biology Lecture 13: October 21, 2004 Scribe: Eitan Reich Lecturer: Ross Lippert Editor: Peter Lee 13.1 Introduction We have been looking at algorithms to
More informationA Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity
A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity G. Pratyusha, Department of Computer Science & Engineering, V.R.Siddhartha Engineering College(Autonomous)
More informationMetaPhyler Usage Manual
MetaPhyler Usage Manual Bo Liu boliu@umiacs.umd.edu March 13, 2012 Contents 1 What is MetaPhyler 1 2 Installation 1 3 Quick Start 2 3.1 Taxonomic profiling for metagenomic sequences.............. 2 3.2
More informationMultiple Sequence Alignment Theory and Applications
Mahidol University Objectives SMI512 Molecular Sequence alysis Multiple Sequence lignment Theory and pplications Lecture 3 Pravech jawatanawong, Ph.. e-mail: pravech.aja@mahidol.edu epartment of Microbiology
More informationHARDWARE ACCELERATION OF HIDDEN MARKOV MODELS FOR BIOINFORMATICS APPLICATIONS. by Shakha Gupta. A project. submitted in partial fulfillment
HARDWARE ACCELERATION OF HIDDEN MARKOV MODELS FOR BIOINFORMATICS APPLICATIONS by Shakha Gupta A project submitted in partial fulfillment of the requirements for the degree of Master of Science in Computer
More informationSimilarity Searches on Sequence Databases
Similarity Searches on Sequence Databases Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Zürich, October 2004 Swiss Institute of Bioinformatics Swiss EMBnet node Outline Importance of
More informationBioinformatics for Biologists
Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover
More informationFrom Smith-Waterman to BLAST
From Smith-Waterman to BLAST Jeremy Buhler July 23, 2015 Smith-Waterman is the fundamental tool that we use to decide how similar two sequences are. Isn t that all that BLAST does? In principle, it is
More informationA Linear Programming Based Algorithm for Multiple Sequence Alignment by Using Markov Decision Process
inear rogramming Based lgorithm for ultiple equence lignment by Using arkov ecision rocess epartment of omputer cience University of aryland, ollege ark hirin ehraban dvisors: r. ern unt and r. hau-en
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 04: Variations of sequence alignments http://www.pitt.edu/~mcs2/teaching/biocomp/tutorials/global.html Slides adapted from Dr. Shaojie Zhang (University
More informationOne report (in pdf format) addressing each of following questions.
MSCBIO 2070/02-710: Computational Genomics, Spring 2016 HW1: Sequence alignment and Evolution Due: 24:00 EST, Feb 15, 2016 by autolab Your goals in this assignment are to 1. Complete a genome assembler
More informationComputational Molecular Biology
Computational Molecular Biology Erwin M. Bakker Lecture 2 Materials used from R. Shamir [2] and H.J. Hoogeboom [4]. 1 Molecular Biology Sequences DNA A, T, C, G RNA A, U, C, G Protein A, R, D, N, C E,
More informationBMI/CS Lecture #22 - Stochastic Context Free Grammars for RNA Structure Modeling. Colin Dewey (adapted from slides by Mark Craven)
BMI/CS Lecture #22 - Stochastic Context Free Grammars for RNA Structure Modeling Colin Dewey (adapted from slides by Mark Craven) 2007.04.12 1 Modeling RNA with Stochastic Context Free Grammars consider
More informationSequence Alignment. GBIO0002 Archana Bhardwaj University of Liege
Sequence Alignment GBIO0002 Archana Bhardwaj University of Liege 1 What is Sequence Alignment? A sequence alignment is a way of arranging the sequences of DNA, RNA, or protein to identify regions of similarity.
More informationShortest Path Algorithm
Shortest Path Algorithm C Works just fine on this graph. C Length of shortest path = Copyright 2005 DIMACS BioMath Connect Institute Robert Hochberg Dynamic Programming SP #1 Same Questions, Different
More informationCS273: Algorithms for Structure Handout # 4 and Motion in Biology Stanford University Thursday, 8 April 2004
CS273: Algorithms for Structure Handout # 4 and Motion in Biology Stanford University Thursday, 8 April 2004 Lecture #4: 8 April 2004 Topics: Sequence Similarity Scribe: Sonil Mukherjee 1 Introduction
More informationA NEW GENERATION OF HOMOLOGY SEARCH TOOLS BASED ON PROBABILISTIC INFERENCE
205 A NEW GENERATION OF HOMOLOGY SEARCH TOOLS BASED ON PROBABILISTIC INFERENCE SEAN R. EDDY 1 eddys@janelia.hhmi.org 1 Janelia Farm Research Campus, Howard Hughes Medical Institute, 19700 Helix Drive,
More informationThe Expectation Maximization (EM) Algorithm
The Expectation Maximization (EM) Algorithm continued! 600.465 - Intro to NLP - J. Eisner 1 General Idea Start by devising a noisy channel Any model that predicts the corpus observations via some hidden
More information