Lab 4: Multiple Sequence Alignment (MSA)
|
|
- Shauna Dixon
- 6 years ago
- Views:
Transcription
1 Lab 4: Multiple Sequence Alignment (MSA) The objective of this lab is to become familiar with the features of several multiple alignment and visualization tools, including the data input and output, basic visualization and editing functions, alignment options, and different between nucleotide and amino acid alignments. A large number of alignment tools are available, but we don t have time to go through them all one by one. Thus we are going to focus on two of them: MAFFT and MUSCLE, since multiple studies have proved both to be of the best performance. For visualization purpose, we use the program Jalview, from which you can invoke these two alignment tools. You are allowed to finish the lab by yourself or with a partner. [Exercise 1] Jalview: Basic Functions 1. Start Jalview 2. choose the file 1ped.fasta in the data directory by going to File > Input alignment > from File. Have a look at the data. Are the sequences well-aligned? 3. Try some basic commands (1) To select a taxa, click on the taxon name on the left side (2) To select all sequences at once, use CTRL-A (3) To deselect all, go to Select > Deselect All (4) To move selected sequences to another point in the data set, hightlight the sequences and use the arrow keys on your keyboard to move the sequences up/down/left/right-ward. 4. You can edit the sequences manually by a) Left click and drag to select where you wish to begin editing b) Right click the hightlighted sequence and then choose Select>Edit>Edit Sequence c) Enter the characters you want to insert, or a space to denote a gap 5. You can undo changes by choosing Edit>Undo
2 6. Close the file with/without saving. [Exercise 2] MSA: MAFFT and MUSCLE Comparison [Part 1: MAFFT] 1. Run a progressive alignment in MAFFT by entering the command mafft retree 2 1ped.fasta > mafft_dna.fasta 2. Once the alignment process is completed, open the result in Jalview. The concensus graph shows the percentage of agreement for each column of the alignment. [Part 2: MUSCLE] 1. Run a standard alignment in MUSCLE by entering the command muscle verbose log muscle_dna.log in 1ped.fasta out muscle_dna.fasta Note that verbose and log are not necessary but you can use them to see the default options in MUSCLE. 2. Open the results in Jalview [Part C: Comparison] 1. Compare the alignment resulting from the previous two parts. Are they different? Which one do you prefer, the MAFFT or MUSCLE alignment? What may be wrong with both? (Hint: this file contains protein-coding genes) 2. Build 2 trees, one from each of your alignments. Go to the alignment window (for both MAFFT and MUSCLE alignments), then click Calculate > Calculate Tree > Neighbor Joining Using %Identity (Note: these trees are great for helping to evaluate your alignments, but this program should never be your tree-building choice) 3. Compare the trees from both alignments. Do the topologies and/or branch lengths differ? [Exercise 3] MAFFT for Nucleotide and Protein Sequence In this exercise we will convert the nucleotide sequences to their equivalent protein sequences
3 and align these instead. Note that because we are running the alignment programs externally to JalView you cannot convert back to the original DNA sequences post alignment. MAFFT and MUSCLE run through the program SeaView can do this, but will not be covered here. [Part 1: Iterative Strategy usin MAFFT] 1. Find the original 1ped.fasta window. 2. Click Calculate > translate cdna 3. Click File > Save as to save the translated sequence as 1ped_aa.fasta 4. Run an iterative alignment in MAFFT by using the command: mafft --maxiterate ped_aa.fasta > mafft_aa_iter.fasta Load this resulted file into JalView. Notice that two new graphs appear along with the alignment: conservation and quality. Conservation measures the number of changes in the physio-chemical properties of the amino acids in any given column of the alignment. Quality is a score that measures the likelihood of changes in each column, given the substitution matrix used to calculate the alignment. For more detail, click Help > Documentation > Alignment Annotations. 5. Build a tree out using your nucleotide alignment by selecting Calculate > Calculate Tree > Neighbor Joining using BLOSUM62. [Part 2: Automatic Strategy usin MAFFT] 1. Find the original 1ped.fasta window, then click Calculate > translate cdna 2. Click File > Save as and save the file as 1ped_aa.fasta with Fasta as the file format. 3. Employ the MAFFT automatic selection of alignment strategy by using the command: mafft --auto 1ped_aa.fasta > mafft_aa_auto.fasta Can you determine which kind of strategy was employed? (hint: mafft outputs data to the screen and the strategy should be listed near the end). Load this file into JalView. Notice that also two new graphs appear along with the alignment: conservation and quality. 4. Build a tree out using your nucleotide alignment by selecting Calculate > Calculate Tree > Neighbor Joining using BLOSUM62.
4 [Part 3: Comparison] Compare amino acid alignments and trees. Which one do you prefer? Does it make sense to align protein-coding sequences using the protein translation, or should you instead build alignments from nucleotide sequences? [Exercise 4] MUSCLE: Does the gap penalty affect the alignment? Here we will run MUSCLE with different gap penalties to observe how this changes the alignment results. [Part 1] 1. Run MUSCLE with a gap-open penalty of -20: muscle verbose log muscle_gap-20.log in 1ped_aa.fasta out muscle_aa_gap-20.fasta gapopen Load the alignment results into Jalview and build a tree as above. [Part 2] 1. Run MUSCLE with a gap penalty of -1: muscle -verbose -log muscle_gap-1.log -in 1ped_aa.fasta -out muscle_aa_gap-1.fasta -gapopen Load the alignment into JalView and build a tree. [Part 3] 1. Run MUSCLE with the default gap penalty: muscle -verbose -log muscle_defgap.log -in 1ped_aa.fasta -out muscle_aa.fasta 2. Load the alignment into JalView and build a tree. [Part 4] Compare the modified gap penalty alignments to the default one. Which one of the three alignments do you prefer, and why? Which has the most gaps? Can you guess the default gap penalty? Can you find in the log files of MUSCLE the gap penalty used?
5 [Exercise 5] BMGE: Trimming Alignments Trimming of an alignment removes the ambiguous columns later analysis. We shall use BMGE for this task. This program calculates column entropy to determine columns that are within biologically expected variation. Any columns above a given entropy threshold are removed. 1. We shall trim the MUSCLE amino acid alignment (muscle_aa.fasta) using BMGE with a conserved entropy threshold of 0.7 and use the BLOSUM62 matrix to determine substitution weights: java -jar BMGE.jar -i muscle_aa.fasta -ofaa muscle_trimmed.fasta -h.7 -m BLOSUM62 -t AA How many columns were removed by BMGE? 2. Load the resulting alignment into JalView and build a tree. Compare to the untrimmed MUSCLE alignment. Has the tree changed? Have the branch lengths changed? Which alignment do you prefer? [Exercise 6] Loading sequences from a public database Jalview can search the EMBL, PDB, PFAM, and Uniprot databases and load sequences so that you may align and analyze them. Try searching through one of these databases and finding sequences you are interested in working with. Make a note of the accession numbers and enter them in step 4, or use the numbers provided below. 1. Close all alignments you have open in Jalview. 2. Click on File > Fetch Sequence(s). 3. Click EMBL in the drop-down menu (or a different database). 4. Enter X53828; X53829; X53930; X5831 (or the numbers of the sequences you found yourself) in the box and then submit 5. Save these sequences in a variety of different formats to analyze as you wish. [Exercise 7] Saving alignments as graphics You may need an image of your alignment for publication. Jalview will allow you to save one in
6 HTML, EPS or PNG format. Open any of the alignments you have worked with so far. 1. To wrap the alignment on the page, click on Format > Wrap. 2. Click on File > Export > HTML and enter a name for your new image.
HORIZONTAL GENE TRANSFER DETECTION
HORIZONTAL GENE TRANSFER DETECTION Sequenzanalyse und Genomik (Modul 10-202-2207) Alejandro Nabor Lozada-Chávez Before start, the user must create a new folder or directory (WORKING DIRECTORY) for all
More information- G T G T A C A C
Name Student ID.. Sequence alignment 1. Globally align sequence V (GTGTACAC) and sequence W (GTACC) by hand using dynamic programming algorithm. The alignment will be performed based on match premium of
More informationGeneious 5.6 Quickstart Manual. Biomatters Ltd
Geneious 5.6 Quickstart Manual Biomatters Ltd October 15, 2012 2 Introduction This quickstart manual will guide you through the features of Geneious 5.6 s interface and help you orient yourself. You should
More informationMultiple Sequence Alignment
Introduction to Bioinformatics online course: IBT Multiple Sequence Alignment Lec3: Navigation in Cursor mode By Ahmed Mansour Alzohairy Professor (Full) at Department of Genetics, Zagazig University,
More informationPFstats User Guide. Aspartate/ornithine carbamoyltransferase Case Study. Neli Fonseca
PFstats User Guide Aspartate/ornithine carbamoyltransferase Case Study 1 Contents Overview 3 Obtaining An Alignment 3 Methods 4 Alignment Filtering............................................ 4 Reference
More informationSalvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón
trimal: a tool for automated alignment trimming in large-scale phylogenetics analyses Salvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón Version 1.2b Index of contents 1. General features
More informationSequence alignment algorithms
Sequence alignment algorithms Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 23 rd 27 After this lecture, you can decide when to use local and global sequence alignments
More informationINTRODUCTION TO BIOINFORMATICS
Molecular Biology-2017 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain
More informationBasic Local Alignment Search Tool (BLAST)
BLAST 26.04.2018 Basic Local Alignment Search Tool (BLAST) BLAST (Altshul-1990) is an heuristic Pairwise Alignment composed by six-steps that search for local similarities. The most used access point to
More informationCISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment
CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features
More informationCompares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.
Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the
More informationHeuristic methods for pairwise alignment:
Bi03c_1 Unit 03c: Heuristic methods for pairwise alignment: k-tuple-methods k-tuple-methods for alignment of pairs of sequences Bi03c_2 dynamic programming is too slow for large databases Use heuristic
More informationINTRODUCTION TO BIOINFORMATICS
Molecular Biology-2019 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain
More informationCS313 Exercise 4 Cover Page Fall 2017
CS313 Exercise 4 Cover Page Fall 2017 Due by the start of class on Thursday, October 12, 2017. Name(s): In the TIME column, please estimate the time you spent on the parts of this exercise. Please try
More informationJET 2 User Manual 1 INSTALLATION 2 EXECUTION AND FUNCTIONALITIES. 1.1 Download. 1.2 System requirements. 1.3 How to install JET 2
JET 2 User Manual 1 INSTALLATION 1.1 Download The JET 2 package is available at www.lcqb.upmc.fr/jet2. 1.2 System requirements JET 2 runs on Linux or Mac OS X. The program requires some external tools
More informationMultiple Sequence Alignment. Mark Whitsitt - NCSA
Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV
More informationMapping Sequence Conservation onto Structures with Chimera
This page: www.rbvi.ucsf.edu/chimera/data/tutorials/systems/outline.html Chimera in BP205A BP205A syllabus Mapping Sequence Conservation onto Structures with Chimera Case 1: You already have a structure
More informationBIR pipeline steps and subsequent output files description STEP 1: BLAST search
Lifeportal (Brief description) The Lifeportal at University of Oslo (https://lifeportal.uio.no) is a Galaxy based life sciences portal lifeportal.uio.no under the UiO tools section for phylogenomic analysis,
More informationBioinformatics for Biologists
Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover
More informationAn Introduction to Taverna Workflows Katy Wolstencroft University of Manchester
An Introduction to Taverna Workflows Katy Wolstencroft University of Manchester Download Taverna from http://taverna.sourceforge.net Windows or linux If you are using either a modern version of Windows
More informationComputational Genomics and Molecular Biology, Fall
Computational Genomics and Molecular Biology, Fall 2015 1 Sequence Alignment Dannie Durand Pairwise Sequence Alignment The goal of pairwise sequence alignment is to establish a correspondence between the
More informationBLAST - Basic Local Alignment Search Tool
Lecture for ic Bioinformatics (DD2450) April 11, 2013 Searching 1. Input: Query Sequence 2. Database of sequences 3. Subject Sequence(s) 4. Output: High Segment Pairs (HSPs) Sequence Similarity Measures:
More informationSequence alignment theory and applications Session 3: BLAST algorithm
Sequence alignment theory and applications Session 3: BLAST algorithm Introduction to Bioinformatics online course : IBT Sonal Henson Learning Objectives Understand the principles of the BLAST algorithm
More informationGLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment
GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment Scoring Dynamic Programming algorithms Heuristic algorithms CLUSTAL W Courtesy of jalview Motivations Collective (or aggregate) statistic
More informationLecture 5 Advanced BLAST
Introduction to Bioinformatics for Medical Research Gideon Greenspan gdg@cs.technion.ac.il Lecture 5 Advanced BLAST BLAST Recap Sequence Alignment Complexity and indexing BLASTN and BLASTP Basic parameters
More informationWorkshop Practical on concatenation and model testing
Workshop Practical on concatenation and model testing Jacob L. Steenwyk & Antonis Rokas Programs that you will use: Bash, Python, Perl, Phyutility, PartitionFinder, awk To infer a putative species phylogeny
More informationEBI services. Jennifer McDowall EMBL-EBI
EBI services Jennifer McDowall EMBL-EBI The SLING project is funded by the European Commission within Research Infrastructures of the FP7 Capacities Specific Programme, grant agreement number 226073 (Integrating
More informationFASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm.
FASTA INTRODUCTION Definition (by David J. Lipman and William R. Pearson in 1985) - Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence
More information.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar..
.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. PAM and BLOSUM Matrices Prepared by: Jason Banich and Chris Hoover Background As DNA sequences change and evolve, certain amino acids are more
More informationJalview Manual and Introductory Tutorial
Jalview 2.8.2 Manual and Introductory Tutorial David Martin, James Procter, Andrew Waterhouse, Saif Shehata, Nancy Giang, Suzanne Duce and Geoff Barton College of Life Sciences, University of Dundee Dundee,
More informationTour Guide for Windows and Macintosh
Tour Guide for Windows and Macintosh 2011 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Suite 100A, Ann Arbor, MI 48108 USA phone 1.800.497.4939 or 1.734.769.7249 (fax) 1.734.769.7074
More informationBioinformatics explained: BLAST. March 8, 2007
Bioinformatics Explained Bioinformatics explained: BLAST March 8, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com Bioinformatics
More informationPage 1.1 Guidelines 2 Requirements JCoDA package Input file formats License. 1.2 Java Installation 3-4 Not required in all cases
JCoDA and PGI Tutorial Version 1.0 Date 03/16/2010 Page 1.1 Guidelines 2 Requirements JCoDA package Input file formats License 1.2 Java Installation 3-4 Not required in all cases 2.1 dn/ds calculation
More informationJalview 2.8. A manual and introductory tutorial. David Martin, James Procter, Andrew Waterhouse, Saif Shehata and Geoff Barton
Jalview 2.8 A manual and introductory tutorial David Martin, James Procter, Andrew Waterhouse, Saif Shehata and Geoff Barton With additional material by Nancy Giang. College of Life Sciences, University
More informationPrinciples of Bioinformatics. BIO540/STA569/CSI660 Fall 2010
Principles of Bioinformatics BIO540/STA569/CSI660 Fall 2010 Lecture 11 Multiple Sequence Alignment I Administrivia Administrivia The midterm examination will be Monday, October 18 th, in class. Closed
More informationPROTEIN MULTIPLE ALIGNMENT MOTIVATION: BACKGROUND: Marina Sirota
Marina Sirota MOTIVATION: PROTEIN MULTIPLE ALIGNMENT To study evolution on the genetic level across a wide range of organisms, biologists need accurate tools for multiple sequence alignment of protein
More informationBLAST, Profile, and PSI-BLAST
BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources
More informationFinding Selection in All the Right Places TA Notes and Key Lab 9
Objectives: Finding Selection in All the Right Places TA Notes and Key Lab 9 1. Use published genome data to look for evidence of selection in individual genes. 2. Understand the need for DNA sequence
More informationParsimony-Based Approaches to Inferring Phylogenetic Trees
Parsimony-Based Approaches to Inferring Phylogenetic Trees BMI/CS 576 www.biostat.wisc.edu/bmi576.html Mark Craven craven@biostat.wisc.edu Fall 0 Phylogenetic tree approaches! three general types! distance:
More informationAlignment of Pairs of Sequences
Bi03a_1 Unit 03a: Alignment of Pairs of Sequences Partners for alignment Bi03a_2 Protein 1 Protein 2 =amino-acid sequences (20 letter alphabeth + gap) LGPSSKQTGKGS-SRIWDN LN-ITKSAGKGAIMRLGDA -------TGKG--------
More informationFast-track to Gene Annotation and Genome Analysis
Fast-track to Gene Annotation and Genome Analysis Contents Section Page 1.1 Introduction DNA Subway is a bioinformatics workspace that wraps high-level analysis tools in an intuitive and appealing interface.
More informationBiology 644: Bioinformatics
Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find
More informationProfiles and Multiple Alignments. COMP 571 Luay Nakhleh, Rice University
Profiles and Multiple Alignments COMP 571 Luay Nakhleh, Rice University Outline Profiles and sequence logos Profile hidden Markov models Aligning profiles Multiple sequence alignment by gradual sequence
More informationGlobal Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties
Global Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties From LCS to Alignment: Change the Scoring The Longest Common Subsequence (LCS) problem the simplest form of sequence
More informationAs of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be
48 Bioinformatics I, WS 09-10, S. Henz (script by D. Huson) November 26, 2009 4 BLAST and BLAT Outline of the chapter: 1. Heuristics for the pairwise local alignment of two sequences 2. BLAST: search and
More informationToday s Lecture. Multiple sequence alignment. Improved scoring of pairwise alignments. Affine gap penalties Profiles
Today s Lecture Multiple sequence alignment Improved scoring of pairwise alignments Affine gap penalties Profiles 1 The Edit Graph for a Pair of Sequences G A C G T T G A A T G A C C C A C A T G A C G
More informationLab 8: Using POY from your desktop and through CIPRES
Integrative Biology 200A University of California, Berkeley PRINCIPLES OF PHYLOGENETICS Spring 2012 Updated by Michael Landis Lab 8: Using POY from your desktop and through CIPRES In this lab we re going
More informationBiochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA)
Biochemistry 324 Bioinformatics Multiple Sequence Alignment (MSA) Big- Οh notation Greek omicron symbol Ο The Big-Oh notation indicates the complexity of an algorithm in terms of execution speed and storage
More informationAlignMe Manual. Version 1.1. Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest
AlignMe Manual Version 1.1 Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest Max Planck Institute of Biophysics Frankfurt am Main 60438 Germany 1) Introduction...3 2) Using AlignMe
More informationHIDDEN MARKOV MODELS AND SEQUENCE ALIGNMENT
HIDDEN MARKOV MODELS AND SEQUENCE ALIGNMENT - Swarbhanu Chatterjee. Hidden Markov models are a sophisticated and flexible statistical tool for the study of protein models. Using HMMs to analyze proteins
More informationCLC Server. End User USER MANUAL
CLC Server End User USER MANUAL Manual for CLC Server 10.0.1 Windows, macos and Linux March 8, 2018 This software is for research purposes only. QIAGEN Aarhus Silkeborgvej 2 Prismet DK-8000 Aarhus C Denmark
More informationMultiple Sequence Alignment
Introduction to Bioinformatics online course: IBT Multiple Sequence Alignment Lec2:Editing & Coloring using Jalview By Ahmed Mansour Alzohairy Professor (Full) at Department of Genetics, Zagazig University,
More informationUser Manual. Ver. 3.0 March 19, 2012
User Manual Ver. 3.0 March 19, 2012 Table of Contents 1. Introduction... 2 1.1 Rationale... 2 1.2 Software Work-Flow... 3 1.3 New in GenomeGems 3.0... 4 2. Software Description... 5 2.1 Key Features...
More information3.4 Multiple sequence alignment
3.4 Multiple sequence alignment Why produce a multiple sequence alignment? Using more than two sequences results in a more convincing alignment by revealing conserved regions in ALL of the sequences Aligned
More informationPackage RWebLogo. August 29, 2016
Type Package Title plotting custom sequence logos Version 1.0.3 Date 2014-04-14 Author Omar Wagih Maintainer Omar Wagih Package RWebLogo August 29, 2016 Description RWebLogo is a wrapper
More informationC E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 13 G R A T I V. Iterative homology searching,
C E N T R E F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U Introduction to bioinformatics 2007 Lecture 13 Iterative homology searching, PSI (Position Specific Iterated) BLAST basic idea use
More informationTutorial: How to use the Wheat TILLING database
Tutorial: How to use the Wheat TILLING database Last Updated: 9/7/16 1. Visit http://dubcovskylab.ucdavis.edu/wheat_blast to go to the BLAST page or click on the Wheat BLAST button on the homepage. 2.
More informationChromatin immunoprecipitation sequencing (ChIP-Seq) on the SOLiD system Nature Methods 6, (2009)
ChIP-seq Chromatin immunoprecipitation (ChIP) is a technique for identifying and characterizing elements in protein-dna interactions involved in gene regulation or chromatin organization. www.illumina.com
More informationLecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:
Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating
More informationAn Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST
An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise
More informationFinding data. HMMER Answer key
Finding data HMMER Answer key HMMER input is prepared using VectorBase ClustalW, which runs a Java application for the graphical representation of the results. If you get an error message that blocks this
More informationSequence Alignment & Search
Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version
More informationTutorial 4 BLAST Searching the CHO Genome
Tutorial 4 BLAST Searching the CHO Genome Accessing the CHO Genome BLAST Tool The CHO BLAST server can be accessed by clicking on the BLAST button on the home page or by selecting BLAST from the menu bar
More informationWilson Leung 01/03/2018 An Introduction to NCBI BLAST. Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment
An Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at https://blast.ncbi.nlm.nih.gov/blast.cgi
More informationApproaches to Efficient Multiple Sequence Alignment and Protein Search
Approaches to Efficient Multiple Sequence Alignment and Protein Search Thesis statements of the PhD dissertation Adrienn Szabó Supervisor: István Miklós Eötvös Loránd University Faculty of Informatics
More informationCLC Sequence Viewer 6.5 Windows, Mac OS X and Linux
CLC Sequence Viewer Manual for CLC Sequence Viewer 6.5 Windows, Mac OS X and Linux January 26, 2011 This software is for research purposes only. CLC bio Finlandsgade 10-12 DK-8200 Aarhus N Denmark Contents
More informationFinding homologous sequences in databases
Finding homologous sequences in databases There are multiple algorithms to search sequences databases BLAST (EMBL, NCBI, DDBJ, local) FASTA (EMBL, local) For protein only databases scan via Smith-Waterman
More informationCAP BLAST. BIOINFORMATICS Su-Shing Chen CISE. 8/20/2005 Su-Shing Chen, CISE 1
CAP 5510-6 BLAST BIOINFORMATICS Su-Shing Chen CISE 8/20/2005 Su-Shing Chen, CISE 1 BLAST Basic Local Alignment Prof Search Su-Shing Chen Tool A Fast Pair-wise Alignment and Database Searching Tool 8/20/2005
More informationTutorial: De Novo Assembly of Paired Data
: De Novo Assembly of Paired Data September 20, 2013 CLC bio Silkeborgvej 2 Prismet 8000 Aarhus C Denmark Telephone: +45 70 22 32 44 Fax: +45 86 20 12 22 www.clcbio.com support@clcbio.com : De Novo Assembly
More informationModule 1 Artemis. Introduction. Aims IF YOU DON T UNDERSTAND, PLEASE ASK! -1-
Module 1 Artemis Introduction Artemis is a DNA viewer and annotation tool, free to download and use, written by Kim Rutherford from the Sanger Institute (Rutherford et al., 2000). The program allows the
More informationIn this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace.
5 Multiple Match Refinement and T-Coffee In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace. This exposition
More informationPyMod 2. User s Guide. PyMod 2 Documention (Last updated: 7/11/2016)
PyMod 2 User s Guide PyMod 2 Documention (Last updated: 7/11/2016) http://schubert.bio.uniroma1.it/pymod/index.html Department of Biochemical Sciences A. Rossi Fanelli, Sapienza University of Rome, Italy
More informationData Mining Technologies for Bioinformatics Sequences
Data Mining Technologies for Bioinformatics Sequences Deepak Garg Computer Science and Engineering Department Thapar Institute of Engineering & Tecnology, Patiala Abstract Main tool used for sequence alignment
More informationChapter 8 Multiple sequence alignment. Chaochun Wei Spring 2018
1896 1920 1987 2006 Chapter 8 Multiple sequence alignment Chaochun Wei Spring 2018 Contents 1. Reading materials 2. Multiple sequence alignment basic algorithms and tools how to improve multiple alignment
More informationChapter 6. Multiple sequence alignment (week 10)
Course organization Introduction ( Week 1,2) Part I: Algorithms for Sequence Analysis (Week 1-11) Chapter 1-3, Models and theories» Probability theory and Statistics (Week 3)» Algorithm complexity analysis
More informationProgramming assignment for the course Sequence Analysis (2006)
Programming assignment for the course Sequence Analysis (2006) Original text by John W. Romein, adapted by Bart van Houte (bart@cs.vu.nl) Introduction Please note: This assignment is only obligatory for
More information24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:
24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid
More informationHomology Modeling FABP
Homology Modeling FABP Homology modeling is a technique used to approximate the 3D structure of a protein when no experimentally determined structure exists. It operates under the principle that protein
More informationTutorial for Windows and Macintosh SNP Hunting
Tutorial for Windows and Macintosh SNP Hunting 2010 Gene Codes Corporation Gene Codes Corporation 775 Technology Drive, Ann Arbor, MI 48108 USA 1.800.497.4939 (USA) +1.734.769.7249 (elsewhere) +1.734.769.7074
More informationUtility of Sliding Window FASTA in Predicting Cross- Reactivity with Allergenic Proteins. Bob Cressman Pioneer Crop Genetics
Utility of Sliding Window FASTA in Predicting Cross- Reactivity with Allergenic Proteins Bob Cressman Pioneer Crop Genetics The issue FAO/WHO 2001 Step 2: prepare a complete set of 80-amino acid length
More informationmpmorfsdb: A database of Molecular Recognition Features (MoRFs) in membrane proteins. Introduction
mpmorfsdb: A database of Molecular Recognition Features (MoRFs) in membrane proteins. Introduction Molecular Recognition Features (MoRFs) are short, intrinsically disordered regions in proteins that undergo
More informationGenome Browsers Guide
Genome Browsers Guide Take a Class This guide supports the Galter Library class called Genome Browsers. See our Classes schedule for the next available offering. If this class is not on our upcoming schedule,
More informationDocumentation of HMMEditor 1.0
Documentation of HMMEditor 1.0 HMMEditor 1.0 stands for profile Hidden Markov Model (phmm) Visual Editor. It is a tool to visualize and edit phmm in HMMer format. HMMer format is also used by Pfam protein
More informationBio3D: Interactive Tools for Structural Bioinformatics.
Bio3D: Interactive Tools for Structural Bioinformatics http://thegrantlab.org/bio3d/ What is Bio3D A freely distributed and widely used R package for structural bioinformatics. Provides a large number
More informationIntroduction to Phylogenetics Week 2. Databases and Sequence Formats
Introduction to Phylogenetics Week 2 Databases and Sequence Formats I. Databases Crucial to bioinformatics The bigger the database, the more comparative research data Requires scientists to upload data
More informationAlgorithmic Approaches for Biological Data, Lecture #20
Algorithmic Approaches for Biological Data, Lecture #20 Katherine St. John City University of New York American Museum of Natural History 20 April 2016 Outline Aligning with Gaps and Substitution Matrices
More informationThe Future of Scientific Software. BioTuple v1.0 User Guide
The Future of Scientific Software BioTuple v1.0 User Guide Copyright 2006-2014 ichemlabs, LLC. All Rights Reserved. No part of this document may be reproduced or transmitted in any form or by any means,
More informationTutorial: Resequencing Analysis using Tracks
: Resequencing Analysis using Tracks September 20, 2013 CLC bio Silkeborgvej 2 Prismet 8000 Aarhus C Denmark Telephone: +45 70 22 32 44 Fax: +45 86 20 12 22 www.clcbio.com support@clcbio.com : Resequencing
More informationAgilent Genomic Workbench Lite Edition 6.5
Agilent Genomic Workbench Lite Edition 6.5 SureSelect Quality Analyzer User Guide For Research Use Only. Not for use in diagnostic procedures. Agilent Technologies Notices Agilent Technologies, Inc. 2010
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 06: Multiple Sequence Alignment https://upload.wikimedia.org/wikipedia/commons/thumb/7/79/rplp0_90_clustalw_aln.gif/575px-rplp0_90_clustalw_aln.gif Slides
More information2 Algorithm. Algorithms for CD-HIT were described in three papers published in Bioinformatics.
CD-HIT User s Guide Last updated: 2012-04-25 http://cd-hit.org http://bioinformatics.org/cd-hit/ Program developed by Weizhong Li s lab at UCSD http://weizhong-lab.ucsd.edu liwz@sdsc.edu 1 Contents 2 1
More informationA multiple alignment tool in 3D
Outline Department of Computer Science, Bioinformatics Group University of Leipzig TBI Winterseminar Bled, Slovenia February 2005 Outline Outline 1 Multiple Alignments Problems Goal Outline Outline 1 Multiple
More informationComparison and Evaluation of Multiple Sequence Alignment Tools In Bininformatics
IJCSNS International Journal of Computer Science and Network Security, VOL.9 No.7, July 2009 51 Comparison and Evaluation of Multiple Sequence Alignment Tools In Bininformatics Asieh Sedaghatinia, Dr Rodziah
More informationBIOINFORMATICS A PRACTICAL GUIDE TO THE ANALYSIS OF GENES AND PROTEINS
BIOINFORMATICS A PRACTICAL GUIDE TO THE ANALYSIS OF GENES AND PROTEINS EDITED BY Genome Technology Branch National Human Genome Research Institute National Institutes of Health Bethesda, Maryland B. F.
More informationManaging big biological sequence data with Biostrings and DECIPHER. Erik Wright University of Wisconsin-Madison
Managing big biological sequence data with Biostrings and DECIPHER Erik Wright University of Wisconsin-Madison What you should learn How to use the Biostrings and DECIPHER packages Creating a database
More informationMultiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences
Multiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences Yue Lu and Sing-Hoi Sze RECOMB 2007 Presented by: Wanxing Xu March 6, 2008 Content Biology Motivation Computation Problem
More informationSequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC--
Sequence Alignment Sequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC-- TAG-CTATCAC--GACCGC--GGTCGATTTGCCCGAC Distance from sequences
More informationUsing Hidden Markov Models for Multiple Sequence Alignments Lab #3 Chem 389 Kelly M. Thayer
Página 1 de 10 Using Hidden Markov Models for Multiple Sequence Alignments Lab #3 Chem 389 Kelly M. Thayer Resources: Bioinformatics, David Mount Ch. 4 Multiple Sequence Alignments http://www.netid.com/index.html
More informationCharacters and Character matrices
Introduction Why? How to Cite Publication Support Credits Help FAQ Web Site Simplicity Files Menus Windows Charts Scripts/Macros Modules How Characters Taxa Trees Glossary New Features Characters and Character
More informationData Walkthrough: Background
Data Walkthrough: Background File Types FASTA Files FASTA files are text-based representations of genetic information. They can contain nucleotide or amino acid sequences. For this activity, students will
More information