Ramachandran Plot. 4ytn. PRO 51 (D) ~l. l TRP 539 (E) Phi (degrees) Plot statistics
|
|
- Rosalyn Bishop
- 5 years ago
- Views:
Transcription
1 B Ramachandran Plot ~b b 135 b ~b PRO 51 (D) ~l l TRP 539 (E) Psi (degrees) 5-5 a SER (B) A ~a L LYS (F) ALA 35 (E) ~b b HIS 59 (G) ALA 173 (E) ASP ALA (F)(A) ASP LYS LYS (B)(E) 315 (A) ~p p ~b (degrees) Plot statistics Residues in most favoured regions [A,B,L] 179.% Residues in additional allowed regions [a,b,l,p].7% Residues in generously allowed regions [~a,~b,~l,~p] 7.% Residues in disallowed regions.% Number of non-glycine and non-proline residues 197.% Number of end-residues (excl. Gly and Pro) 1 Number of glycine residues (shown as triangles) 19 Number of proline residues Total number of residues 9 Based on an analysis of 11 structures of resolution of at least. Angstroms and R-factor no greater than %, a good quality model would be expected to have over % in the most favoured regions. _1.ps
2 Ramachandran plots for all residue types Page 1 Ala () Arg (1) Asn (7) E 9 F 11 Psi F G E E A D Asp (11) Cys (5) Gln () F 9 Psi A 191 E A - B F Glu (1) Gly (19) His (7) Psi F 91 E 55 H C 59 G E 5 A A E Numbers of residues are shown in brackets. Those in unfavourable conformations (score < -3.) are labelled. Shading shows favourable conformations as obtained from an analysis of 13 structures at resolution.a or better. _.ps
3 Ramachandran plots for all residue types Page Ile (15) Leu () Lys (1) Psi B F 1 B 93 A E B 3 F 3 H E A Met () Phe (9) Pro (11) G 113 A E 379 H 9 G 15 H D Psi B 3 A E Ser () Thr (15) Trp (3) B 1 F 1 Psi - F 35 - E 533 C Numbers of residues are shown in brackets. Those in unfavourable conformations (score < -3.) are labelled. Shading shows favourable conformations as obtained from an analysis of 13 structures at resolution.a or better. _.ps
4 Ramachandran plots for all residue types Page 3 Tyr () A 35 Val (1) A E 17 Psi - - B F Numbers of residues are shown in brackets. Those in unfavourable conformations (score < -3.) are labelled. Shading shows favourable conformations as obtained from an analysis of 13 structures at resolution.a or better. _.ps
5 Chi1-Chi plots Page 1 Arg (1) Asn (7) Asp (11) F Chi- 7 7 E 3 7 E A E 59 7 Chi-1 7 Chi-1 7 Chi-1 Cys () Gln () Glu (1) Chi- 7 Chi-1 7 Chi-1 7 Chi-1 His (7) Ile (15) Leu () Chi- 7 E 39 A 39 C 179 G A 3 E 3 G 11 H D G 1 G 15 C 15 D E G 39 1 H H 5 G 59 D 53 G C 7 F 1 B 1 E H Chi-1 7 Chi-1 7 Chi-1 Numbers of residues are shown in brackets. Those in unfavourable conformations (score < -3.) are labelled. Shading shows favourable conformations as obtained from an analysis of 13 structures at resolution.a or better. _3.ps
6 Chi1-Chi plots Page Lys (1) Met () Phe (9) Chi- A 153 E Chi-1 7 Chi-1 7 Chi-1 Trp (3) Tyr () G 9 Chi- 7 D 15 H 15 7 C 11 G 11 A 539 E Chi-1 7 Chi-1 Numbers of residues are shown in brackets. Those in unfavourable conformations (score < -3.) are labelled. Shading shows favourable conformations as obtained from an analysis of 13 structures at resolution.a or better. _3.ps
7 %-tage of residues in most favoured regions Bad contacts per residues Main-chain parameters a. Ramachandran plot quality assessment Resolution (Angstroms) c. Measure of bad non-bonded interactions 7 Standard deviation (degrees) Zeta angle standard dev. (degrees) b. Peptide bond planarity - omega angle sd Resolution (Angstroms) d. Alpha carbon tetrahedral distortion Standard deviation (kcal/mol) Resolution (Angstroms) e. Hydrogen bond energies G-factor Resolution (Angstroms) f. G-factor Resolution (Angstroms) Resolution (Angstroms) Plot statistics Comparison values No. of No. of Parameter Typical Band band widths Stereochemical parameter data pts value value width from mean a. %-tage residues in A, B, L BETTER b. angle st dev Inside c. Bad contacts / residues BETTER d. Zeta angle st dev BETTER e. H-bond energy st dev BETTER f. G-factor BETTER _.ps
8 5 Side-chain parameters a. Chi-1 gauche minus 5 b. Chi-1 trans Standard deviation (degrees) Standard deviation (degrees) Resolution (Angstroms) Resolution (Angstroms) 5 c. Chi-1 gauche plus 5 d. Chi-1 pooled standard deviation Standard deviation (degrees) Standard deviation (degrees) Resolution (Angstroms) e. Standard deviation of Chi- trans angle Resolution (Angstroms) Standard deviation (degrees) Resolution (Angstroms). Plot statistics Comparison values No. of No. of Parameter Typical Band band widths Stereochemical parameter data pts value value width from mean a. Chi-1 gauche minus st dev BETTER b. Chi-1 trans st dev BETTER c. Chi-1 gauche plus st dev BETTER d. Chi-1 pooled st dev BETTER e. Chi- trans st dev BETTER _5.ps
9 1 1 A deviate by more than. st. devs. from ideal Page 1 SN I AQYKV I DHAYDVV I I GAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGG I NAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEA Chi1-chi Chi3 & chi + * + + * * * *. *.. *.... *. + *.. + *. * *+. + * + * * + * + * + * + * * + * + *..... * * * * * * + * *. *. * * * *+.. * * * *..... * * * + * * * * * * * + * *.. + *. * + * * *+.. * * + * + * + *. + * * + * + *.. + * * * * _.ps
10 Page deviate by more than. st. devs. from ideal VTELENFGMPFSRTPEGK I YQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFF I EYFALDLLMDKGRCVGV I ALCLEDGT I HRFRS Chi1-chi Chi3 & chi * * *. * + * *. *.. * + * * *. * * + * *. * *... * + * * *+. * + * *. * * *.. *. * + * + * * *. * * *+. * ** * * + + * * * *. * * * * * * *. * * * *. * *. * 1. * * + * + + * * + * * * * * *.. * * * * * *. *. * *. * * * * * *. * * + * * *. *. * * * * * + * * _.ps
11 Page deviate by more than. st. devs. from ideal KRT I VATGGYGRAYFSCTTAHMNTGDGTALATRAG I ALEDLEF I QFHPTG I YGVGCL I TEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAET I Chi1-chi Chi3 & chi * * +. * * * *. * +... * *.. *.... * + *. * *... * *. * *+. * + * + * + * * * * * + * * * + * + * * + * *+ * * + * * ** *.. * *+ * + * * + * * + * + * * * + * *. *.... * + * *+ * *. * * * * * +. * * * * * * * + * + *. * **. * +.. * + * + * * * _.ps
12 Page deviate by more than. st. devs. from ideal E IMEGRGVGPEKDH I YLQLHHLPAEQLHQRLPG I SETAK I FAGVDVTKEP I PV I PTVHYNMGG I PTNYKAQV I KYTKEGGDK I VPGLYACGECACHSVHG Chi1-chi Chi3 & chi _.ps * + * * * * * + * * *. * * * *. + *. + * * + *. * *+. + * + *.. * * * *. * *+ + * * * ** * * * * * *. *. * * * * **+ *. * * **. + *. + * + * * ** * * * *. + * * * *. *. * ** * *. * * * * * * *+ * * *+ *.. * *.. + * * *. + * + *. * + *. *. *... * * c = cis-peptide + c c
13 Page deviate by more than. st. devs. from ideal ANRLGANSLLDAVVFGRACS I N I KEELKPDEK I PELPEGAGEES I ANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGD I LAEGVKKMMDLFKELKR Chi1-chi Chi3 & chi. * * + * * * + * + * + *. * *+ * +. * + * * +.. * +. *.. * * + * + * ** * + * *. * + *. * + * * * ** * + *... * * + *... * * * +.. * *. * * * * + *. *. * * + *. *. *. * + * + * *+ * + * + * *+. * * + * * * ** * * + * *... * * * * +. * +. * + * * *+ * *+ * * * * _.ps
14 Page deviate by more than. st. devs. from ideal LKTTDRSL IWNSDLTESLELQNLMLNATQT I VAAENRKESRGAHARDDFPKREDEYDYSKP I EGQTKRPFEKHWRKHTLTKQDPRTGH I TLDYRPV I DKT Chi1-chi Chi3 & chi * * * *.. * * + * * *+. * **. * *+. *. * * * *+ *. * *.. * * * * + * + * * + * * * *.. + * + * + * * + *... *. * * *. * + * + * * * * * * + * * ** * + * *. * *+ * * + *.. + * * + * + * *.... * + * * * + *. * *+ * *+ * *. * * + * * + * *. * + *. * + * * _.ps
15 deviate by more than. st. devs. from ideal B Page 7 LDPAEVDWI PP I I RSY KR I KTFE I YRFNPEEPGAKPKLQKFDVDLDKCGTMVLDAL I K I KNEVDPTLTFRRSCREG I CGSCAMN I AGENT Chi1-chi Chi3 & chi *. *... * * + * * * +... * +. * * * * * * + * + * + * *. *.. * * *+. * + * + * * + * + * + * * * +.. * *+.. * * * + * + * * * ** * * * * * * + *. * * * * * *+ * * * *. * *+. * + * + * + * * * * *+... * * * *+. *. *. * * *. * _.ps
16 Page deviate by more than. st. devs. from ideal LAC I CN I DQNTSKTTK I YPLPHMFV I KDLVPDMNLFYAQYAS I QPWLQKKTK I NLGEKQQYQS I KEQEKLDGLYEC I LCACCSASCPSYWWNADKYLGPA Chi1-chi Chi3 & chi * * 1 + * * * *. + * *. + *. + * + * + * + * * * * * * * *. * + * + *. * * * * * *. * + * * ** * + * * *+ * + *. *. * *. * * * * *.... *. * * * * * **+ + * * * + *. * * + *. * * + *. * *+ * * + * *.. + * *. *. * *. + *... * + *. * * * * + * * *. * * * * * * _.ps
17 deviate by more than. st. devs. from ideal C Page 9 VLMQAYRWI I DSRDDSAAERLARMQDGFSAFKCHT IMNCTKTCPKHLNPARA I GE I KMLLTKMKTKPAPLPTPANF EKTP I QVWGWDYLM Chi1-chi Chi3 & chi * * * + * *.. *. * * * * * * *. * * * * *.. + *. * + * * *. * *. + * + * * *. *. *. + *. * * * + * * + *.. + * + * * *. * *. + * *. *. * *. * *+ * + * + * * *. + * + * *. + *. *.. + *. *. *.. + * *. *. + * _.ps
18 Page deviate by more than. st. devs. from ideal RQRALKRP I APHLT I YKPQMTWMVSGLHRVTGCAMAGTLL I GGVGF SVLPLDFTTFVEF I RGLG I PWV I LDTFKF I I AF P I AFHTLNG I RF I GFDMAKGT Chi1-chi Chi3 & chi + * * *. *. + *. * *. * * *.. + * + * + * *. + * * ** * *. + * + * * * * * + * + * + *. + * * + * * * *. * + * * * + *. * * * + * + * * * *. *. + *.. * * * * * * * + *. + * + * * *.. + * + *... *. * * * * + * * * * * * * *+ * *. + * * * *.. + * *. + * + * * * _.ps
19 deviate by more than. st. devs. from ideal D Page 11 D I PS I YRGAYLVLGLAAL I SLAVVVYPRWERHKKATLPT TSAAVTGAAPPQFDP I AAEKGFKPLHSHGTLFK I ERYFAAAMVPL I PAAYF Chi1-chi Chi3 & chi * + * * + * * * * * * * *. * * * * + * *. * *+ + * *.. + * * * * *+. * + * * * * * *+ + * * *+ * **+ + * * *+ * *.. *+ * * * **+ + *.... * + * *. + * *. *. * *+ * * * * * ** * *** * * + * + *. + * * + *. * + * + * * + * * * *. * *. * * *+ + *. + * * * * * _.ps
20 deviate by more than. st. devs. from ideal E Page 1 I HGREMDLCLALALTLHVHWGVWGVVNDYGRPFVLGDTLAAAVRVGAY I FTACLLAGLLYFNEHDVGLTRAFEMVWEL SN I AQYKV I DHA Chi1-chi Chi3 & chi + * + * * + * * * + * *+ * *.. * * * * * *. * * * *. *.. * * * *.. * * * *. * * *. * * * **+ * + * * + * + *. *. * * + * * * * *. *. * * * *. * *+ + * *. + * * + * + * * + * + *.. * * + * * + * * **. + * * **+ * *+ * * * *. * _.ps
21 Page deviate by more than. st. devs. from ideal YDVV I I GAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGG I NAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFS Chi1-chi Chi3 & chi + * * *. * * * + *. * * * *.. + *. * + * + * * *. + * + * + * + * * *. *.. * * * + *. * * * *. *. * * * **. * * + *.... * + *. * *. * * * * + * *. * + * *. * + * * *+.. * *+ + *. + * * + * * * *. * * + * + * *. * * + * *. * + * + * * + * * * * _.ps
22 Page deviate by more than. st. devs. from ideal RTPEGK I YQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFF I EYFALDLLMDKGRCVGV I ALCLEDGT I HRFRSKRT I VATGGYGR Chi1-chi Chi3 & chi * * *.. * * * * *+. *. *. * *+ + * * + * * *+. * * * * *+. + *. * * + * * *. + * * ** + * * ** * * * * * * * * *. * * *. *... * * *. + * * * * + * + + * * * + * * * *. * * * * * + *. *. + *.. + * + * * * *. * * + * + *. * *. + *. * * *+. *. *. * **. * *.. * _.ps
23 Page deviate by more than. st. devs. from ideal AYFSCTTAHMNTGDGTALATRAG I ALEDLEF I QFHPTG I YGVGCL I TEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAET I E IMEGRGVGPEK Chi1-chi Chi3 & chi.. *... * * *. * *... * *+ * * * *. * * + *.. + *..... * * *+ + * * + * * **. * ** * * *+. + *. * *+ + * + * + * * + * * *.... *.. * * + * * *+ * *. * * * * + *. * * *. * **. + * + *. * **. *. + * + * * *. * * + * * + *. + * * *+ * **. * * + * * * _.ps
24 Page deviate by more than. st. devs. from ideal DH I YLQLHHLPAEQLHQRLPG I SETAK I FAGVDVTKEP I PV I PTVHYNMGG I PTNYKAQV I KYTKEGGDK I VPGLYACGECACHSVHGANRLGANSLLDA Chi1-chi Chi3 & chi _.ps * * *. * *+. + * + *.. + * *.. + * * *+. * * *. *. *.. *. * * * ** * 7. * * *. + * * * + * * ** * *. * * * * * *+. *. * *+ + *.. * * * *... + *. * * * * * * + * *. + *. * * * * * * *+ + *.. * *. + * * + *.. *. *. * * * * *+ + * * * * ** * *. + * * *+ * c = cis-peptide c c
25 Page deviate by more than. st. devs. from ideal VVFGRACS I N I KEELKPDEK I PELPEGAGEES I ANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGD I LAEGVKKMMDLFKELKRLKTTDRSL IWNS Chi1-chi Chi3 & chi. * + * + * * * + * * + * + * * + * +. * + * * + * + * + * * +. * *+. * + * + *. *.. * + * *.. * *.... * * * + * *.. * *. * +... * + *. * * + * * * * + * **... *. * *. *. * * * *. * *+ * * * *. * +. * * * * * **. * + * * * * +. * * *+. * +. * ** * + * _.ps
26 Page deviate by more than. st. devs. from ideal DLTESLELQNLMLNATQT I VAAENRKESRGAHARDDFPKREDEYDYSKP I EGQTKRPFEKHWRKHTLTKQDPRTGH I TLDYRPV I DKTLDPAEVDWI PP I Chi1-chi Chi3 & chi + * * *. * + * * * * *.. * *. * + * + * * * * + *.. * * + * * * * * + *. *. + * * * * * + * * + * * * + * * ** * + + * *. * * * * * + * + *. * * * * + * *. * + * * * * * *... * *+ *. * * * *.. + *. * *. + * + *. + * *. * * *... * * + * * * * _.ps
27 deviate by more than. st. devs. from ideal F Page 19 I RSY KR I KTFE I YRFNPEEPGAKPKLQKFDVDLDKCGTMVLDAL I K I KNEVDPTLTFRRSCREG I CGSCAMN I AGENTLAC I CN I DQNTS * Chi1-chi Chi3 & chi * *. *. * * * + * + * * + * + * * + *.. * * *+ + * * * * + * * * *. * + *.. * *. * * * + *.. * * * * *... *. + * *.5 * * *. * *.. * * + *. + * * * * * * * *. * **. + *.. *. * *. + *. *.. + * + * + * * * * + * * _.ps
28 Page deviate by more than. st. devs. from ideal KTTK I YPLPHMFV I KDLVPDMNLFYAQYAS I QPWLQKKTK I NLGEKQQYQS I KEQEKLDGLYEC I LCACCSASCPSYWWNADKYLGPAVLMQAYRWI I DS Chi1-chi Chi3 & chi * *+ * + *. * *. * * * * *. * *. * ***.. + * * **+ * ** *. * *. * * * + * + *. *... + * * * * + * * * ***. * *+ * * * * * + * * * + * + * * * *. * * + * + * * *. * *. *. + * * *... + * * * *. *. + * *. * * *. * * *.. * *.. + * + *. * *. + * _.ps
29 deviate by more than. st. devs. from ideal G Page 1 RDDSAAERLARMQDGFSAFKCHT IMNCTKTCPKHLNPARA I GE I KMLLTKMKTKPAPLPTPANF EKTP I QVWGWDYLMRQRALKRP I APH Chi1-chi Chi3 & chi. * * + * + * + * +.. * * + * + * + * +. * * +. * * * *+. * +. * * * + *. * + * *. * * * * * + * * +. * * * * *.. * * * +. * * * + * * * * * +. * * ** *. * +.. *. * +. *. * *.. * * * + * * * * * + * + * * * * * *.. * * * _.ps
30 Page deviate by more than. st. devs. from ideal LT I YKPQMTWMVSGLHRVTGCAMAGTLL I GGVGF SVLPLDFTTFVEF I RGLG I PWV I LDTFKF I I AF P I AFHTLNG I RF I GFDMAKGTD I P S I YRGAYLV Chi1-chi Chi3 & chi + + * * + + * * *. * * * *. * * *. + * + * + *. * * * + * + * + * * * * *.. + *. *. *. + * * *. * + *. *. * * *. *. + * * + * * * + * + * * * + *. * * * + *.. * * * + * * * * + *. + *. * + * * * + * + *.. *.. * * * * * + * + * + * + * *.. * + * * * * + * + * _.ps
31 deviate by more than. st. devs. from ideal H Page 3 LGLAAL I SLAVVVYPRWERHKKATLPT TSAAVTGAAPPQFDP I AAEKGFKPLHSHGTLFK I ERYFAAAMVPL I PAAYF I HGREMDLCLAL Chi1-chi Chi3 & chi * * * * + * * * + *. *. * * * ** * * * **. * * * + * * * * * + * * *+ + * * *+ + * * *+.. * * * 5.. * *+ * *. + * * * + * * * * * * *... * *+. + * * ** * ** + * * * * *.. * * *. * * * * * * *.. * * * * * + * *. + * + * * * * + * + * * * * * + * * * + *. * _.ps
32 Page deviate by more than. st. devs. from ideal ALTLHVHWGVWGVVNDYGRPFVLGDTLAAAVRVGAY I FTACLLAGLLYFNEHDVGLTRAFEMVWEL * * *+ * * * + * * +. * * * * * * * + * + * * ** * + * + *. * *+ * *+ * + *. * +.. * * * + * +. * *.. * * + * + * * * + * * * * +. * * *+ * *+. * *. * + *.. * * * * * * * *+ * *. Chi1-chi Chi3 & chi Ave _.ps
33 C-N (except Pro) Main-chain bond lengths C-N (Pro) C-O Page CA-C (except Gly) CA-C (Gly) CA-CB (Ala) CA-CB (Ile,Thr,Val) CA-CB (the rest) N-CA (except Gly,Pro) N-CA (Gly) N-CA (Pro) Black bars >. st. devs. from mean. Solid and dashed lines represent the mean and standard deviation values as per Engh & Huber small-molecule data. _7.ps
34 CA-C-N (except Gly,Pro) Main-chain bond angles CA-C-N (Gly) CA-C-N (Pro) Page O-C-N (except Pro) O-C-N (Pro) C-N-CA (except Gly,Pro) C-N-CA (Gly) C-N-CA (Pro) CA-C-O (except Gly) CA-C-O (Gly) CB-CA-C (Ala) CB-CA-C (Ile,Thr,Val) Black bars >. st. devs. from mean. Solid and dashed lines represent the mean and standard deviation values as per Engh & Huber small-molecule data. _.ps
35 CB-CA-C (the rest) Main-chain bond angles N-CA-C (except Gly,Pro) N-CA-C (Gly) Page N-CA-C (Pro) N-CA-CB (Ala) N-CA-CB (Ile,Thr,Val) N-CA-CB (Pro) N-CA-CB (the rest) Black bars >. st. devs. from mean. Solid and dashed lines represent the mean and standard deviation values as per Engh & Huber small-molecule data. _.ps
36 RMS distances from planarity ARG ASN ASP Page GLN GLU HIS PHE TRP TYR Histograms showing RMS distances of planar atoms from best-fit plane. Black bars indicate large deviations from planarity: RMS dist >.3 for rings, and >. otherwise. _9.ps
Supplementary Information
Supplementary Information Supplementary Figure S1 The scheme of MtbHadAB/MtbHadBC dehydration reaction. The reaction is reversible. However, in the context of FAS-II elongation cycle, this reaction tends
More information1. Open the SPDBV_4.04_OSX folder on the desktop and double click DeepView to open.
Molecular of inhibitor-bound Lysozyme This lab will not require a lab report. Rather each student will follow this tutorial, answer the italicized questions (worth 2 points each) directly on this protocol/worksheet,
More informationBuilding and Animating Amino Acids and DNA Nucleotides in ShockWave Using 3ds max
1 Building and Animating Amino Acids and DNA Nucleotides in ShockWave Using 3ds max MIT Center for Educational Computing Initiatives THIS PDF DOCUMENT HAS BOOKMARKS FOR NAVIGATION CLICK ON THE TAB TO THE
More informationSupporting information
Supporting information 1S. DECOMP output for the peptide amino-acid decomposition test with monoisotopic mass = 1000 +/- 0.2 # imsdecomp 1.3 # Copyright 2007,2008 Informatics for Mass Spectrometry group
More informationRB-Tree Augmentation. OS-Rank. OS-Select. Augment x with Size(x), where. Size(x) = size of subtree rooted at x Size(NIL) = 0
RB-Tree Augmentation Augment x with Size(x), where Size(x) = size of subtree rooted at x Size(NIL) = 0 COT 5407 10/6/05 1 OS-Rank OS-RANK(x,y) // Different from text (recursive version) // Find the rank
More informationGiri Narasimhan & Kip Irvine
COP 4516: Competitive Programming and Problem Solving! Giri Narasimhan & Kip Irvine Phone: x3748 & x1528 {giri,irvinek}@cs.fiu.edu Problems to think about!! What is the least number of comparisons you
More informationGreedy Algorithms Huffman Coding
Greedy Algorithms Huffman Coding Huffman Coding Problem Example: Release 29.1 of 15-Feb-2005 of TrEMBL Protein Database contains 1,614,107 sequence entries, comprising 505,947,503 amino acids. There are
More informationAssignment 4. the three-dimensional positions of every single atom in the le,
Assignment 4 1 Overview and Background Many of the assignments in this course will introduce you to topics in computational biology. You do not need to know anything about biology to do these assignments
More informationHomework Python-1. Sup Biotech 3 Python. Pierre Parutto
Homework Python-1 Sup Biotech 3 Python Pierre Parutto November 7, 2016 Preamble Document Property Authors Pierre Parutto Version 1.0 Number of pages 14 Contact Contact the assistant team at: supbiotech-bioinfo-bt3@googlegroups.com
More informationHomework Python-1. Sup Biotech 3 Python. Pierre Parutto
Homework Python-1 Sup Biotech 3 Python Pierre Parutto October 9, 2016 Preamble Document Property Authors Pierre Parutto Version 1.0 Number of pages 9 Contact Contact the assistant team at: supbiotech-bioinfo-bt3@googlegroups.com
More informationMachine Learning Methods. Majid Masso, PhD Bioinformatics and Computational Biology George Mason University
Machine Learning Methods Majid Masso, PhD Bioinformatics and Computational Biology George Mason University Introductory Example Attributes X and Y measured for each person (example or instance) in a training
More informationSAY IT WITH DNA: Making New Messages
Y WH : Making New Messages ince you will be expected to decipher a message in the unit exam, it would be wise to get as much practice as possible. f you can have fun in the process, so much the better!
More informationMolecular Modeling Protocol
Molecular Modeling of an unknown protein 1. Register for your own SWISS-MODEL Workspace at http://swissmodel.expasy.org/workspace/index. Follow the Login link in the upper right hand corner. Bring your
More informationStructure Calculation using CNS
http://cns-online.org/v1.21/ Structure Calculation using CNS DO THE FOLLOWING, IF YOU HAVE NOT ALREADY DONE SO: First, look in your home directory to see if there is a subdirectory named cns : [your-user-name@localhost
More informationPlease cite the following papers if you perform simulations with PACE:
Citation: Please cite the following papers if you perform simulations with PACE: 1) Han, W.; Schulten, K. J. Chem. Theory Comput. 2012, 8, 4413. 2) Han, W.; Wan, C.-K.; Jiang, F.; Wu, Y.-D. J. Chem. Theory
More informationProtein Structure Hierarchy
Protein Structure Hierarchy Introduction With great insight - before the first 3D protein structure was determined, the Danish chemist Kaj Linderstrøm-Lang (the father of physical biochemistry), reasoned
More informationGlobal Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties
Global Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties From LCS to Alignment: Change the Scoring The Longest Common Subsequence (LCS) problem the simplest form of sequence
More informationAn End-to-End Web Services-based Infrastructure for Biomedical Applications
An End-to-End Web Services-based Infrastructure for Biomedical Applications Sriram Krishnan *, Kim K. Baldridge, Jerry P. Greenberg, Brent Stearn and Karan Bhatia * sriram@sdsc.edu Modeling and Analysis
More informationPython for Bioinformatics
Python for Bioinformatics A look into the BioPython world... Christian Skjødt csh@cbs.dtu.dk Today s program 09-10: 10-12: 12-13: 13-13.30: 13.30-16: 16:00-17: Lecture: Introduction to BioPython Exercise:
More informationBiopython. Karin Lagesen.
Biopython Karin Lagesen karin.lagesen@bio.uio.no Object oriented programming Biopython is object-oriented Some knowledge helps understand how biopython works OOP is a way of organizing data and methods
More informationNote. Some tutorials require data files that can be downloaded here:
Discovery Studio 2.0 Tutorials Version 1.0 : Note. Some tutorials require data files that can be downloaded here: http://www.accelrys.com/doc/life/dstudio/20/tutorials/tutorialdata.zip. Save the zip file
More informationPacific Symposium on Biocomputing 5: (2000)
IDENTIFYING AMINO ACID RESIDUES IN MEDIUM RESOLUTION CRITICAL POINT GRAPHS USING INSTANCE BASED QUERY GENERATION K. WHELAN, J. GLASGOW Instance Based Query Generation is dened and applied to the problem
More informationScience Olympiad Protein Modeling Event Guide to Scoring Zinc Finger Motif
Science Olympiad Protein Modeling Event Guide to Scoring Zinc Finger Motif Once you have folded the zinc finger motif (chain C, residues 4-31 of 1ZAA.pdb), use this guide in conjunction with the rubric
More informationNote: Note: Input: Output: Hit:
MS/MS search 8.9 i The ms/ms search of GPMAW is based on the public domain search engine X! Tandem. The X! Tandem program is a professional class search engine; Although it is able to perform proteome
More informationExploring the Interplay between Virology and Molecular Crystallography
p. 1/?? Exploring the Interplay between Virology and Molecular Crystallography 1. Molecular crystallography 2. Crystallographic scaling 3. Integral lattices 4. Axial-symmetric clusters - in rhinovirus
More informationIvelin Georgiev and Bruce R. Donald. Copyright (C) Bruce Donald Lab, Duke University
Ivelin Georgiev and Bruce R. Donald Copyright (C) 2001-2009 Bruce Donald Lab, Duke University Contents 1 Introduction 2 1.1 Modeling Flexibility.................................... 3 2 Installation 6 3
More informationCS483 Assignment #1 Molecular Visualization and Python
CS483 Assignment #1 Molecular Visualization and Python Due date: Thursday Jan. 22 at the start of class. Hand in on Tuesday Jan. 20 for 5 bonus marks. General Notes for this and Future Assignments: Chimera
More informationHomology Modeling Professional for HyperChem Release Notes
Homology Modeling Professional for HyperChem Release Notes This document lists additional information about Homology Modeling Professional for HyperChem. Current Revision Revision H1 (Version 8.1.1) Current
More informationIntroduction to the Protein Data Bank Master Chimie Info Roland Stote Page #
Introduction to the Protein Data Bank Master Chimie Info - 2009 Roland Stote The purpose of the Protein Data Bank is to collect and organize 3D structures of proteins, nucleic acids, protein-nucleic acid
More informationChemBio3D. Director of Software Marketing CambridgeSoft (617) Skype: jessegordon. Nov. 12, 2009
ChemBio3D Tips & Tricks Jesse Gordon Director of Software Marketing CambridgeSoft jgordon@cambridgesoft.com (617) 320-6989 Skype: jessegordon 1 Nov. 12, 2009 ChemBio3D Tips & Tricks: Presentation Outline
More informationVersion 1.0 November2016 Hermes V1.8.2
Hermes in a Nutshell Version 1.0 November2016 Hermes V1.8.2 Table of Contents Hermes in a Nutshell... 1 Introduction... 2 Example 1. Visualizing and Editing the MLL1 fusion protein... 3 Setting Your Display...
More informationクートオオバン. Introduction to Coot
大鷭大鳥類 クートオオバン Introduction to Coot Model-Building with Coot: An Introduction and low resolution tools Bernhard Lohkamp Karolinska Institutet Bernhard.Lohkamp@ki.se Tsukuba PF November 2014 Paul Emsley
More informationProject 6: Extracting Data from PDB Files
: Extracting Data from PDB Files Overview In this assignment, your Perl program will let a user get information about a macromolecule represented by a PDB le whose pathname is specied on the command line.
More informationÀ ß â ß 3 µ Õß xylan-binding xylanase Bacillus fimus K-1 â««homology modeling
««æ π. ªï Ë 29 Ë 3 Æ - π π 2549 335 À ß â ß 3 µ Õß xylan-binding xylanase Bacillus fimus K-1 â««homology modeling æ µ æ Õ Õß ÿµ 1 π å Ÿ 2 π µπ π 3* À «π æ Õ â π ÿ ß ÿàß ÿ ÿß æœ 10140 ÿ æß å æ π ß 4 À «ÀÕ
More informationSimDiv: a New Solution for Protein Comparison
SimDiv: a New Solution for Protein Comparison Hassan Sayyadi 1, Sara Salehi 2, and Mohammad Ghodsi 3 1 Computer Engineering Department, Sharif University of Technology, sayyadi@ce.sharif.edu 2 Computer
More informationComputational Crystallography Newsletter
Volume Five Computational Crystallography Newsletter July MMXIV FAB elbow, Map Connectivity, CDL Table of Contents PHENIX News 31 Crystallographic meetings 32 Expert Advice Fitting tips #8 Acetyl Groups
More informationA First Introduction to Scientific Visualization Geoffrey Gray
Visual Molecular Dynamics A First Introduction to Scientific Visualization Geoffrey Gray VMD on CIRCE: On the lower bottom left of your screen, click on the window start-up menu. In the search box type
More informationModel-Building of Proteins Using X-ray Data With Coot. Paul Emsley May 2013
Model-Building of Proteins Using X-ray Data With Coot Paul Emsley May 2013 Which coot? Coot-0.7.1-pre revision 4600 (or so) Linux: http://www.ccp4.ac.uk/coot/nightlies/pre-release/ Mac OS X Windows Bill
More informationMetadynamics and parallel tempering metadynamics. practical session
Metadynamics and parallel tempering metadynamics practical session Ludovico Sutto l.sutto@ucl.ac.uk Algorithm in Structural Bioinformatics 25-29 November 2013, Toulouse www.plumed-code.org works with many
More informationIntroduction to Hermes
Introduction to Hermes Version 2.0 November 2017 Hermes v1.9 Table of Contents Introduction... 2 Visualising and Editing the MLL1 fusion protein... 2 Opening Files in Hermes... 3 Setting Style Preferences...
More informationAssignment 4: Molecular Dynamics (50 points)
Chemistry 380.37 Fall 2015 Dr. Jean M. Standard November 2, 2015 Assignment 4: Molecular Dynamics (50 points) In this assignment, you will use the Tinker molecular modeling software package to carry out
More informationCS612 - Algorithms in Bioinformatics
Fall 2017 Structural Manipulation November 22, 2017 Rapid Structural Analysis Methods Emergence of large structural databases which do not allow manual (visual) analysis and require efficient 3-D search
More informationSupplemental Information. A New Generation of Crystallographic Validation. Tools for the Protein Data Bank
Structure 19 Supplemental Information A New Generation of Crystallographic Validation Tools for the Protein Data Bank Randy J. Read, Paul D. Adams, W. Bryan Arendall III, Axel T. Brunger, Paul Emsley,
More informationProtein structure. Enter the name of the protein: rhamnogalacturonan acetylesterase in the search field and click Go.
In this practical you will learn how to Protein structure search the Protein Structure Databank for information critically choose the best structure, when more than one is available visualize a protein
More informationTo execute this program all we need to do is to type the name of the file (plotlog) in MATLAB main console and the complete file will be executed.
Programs and functions While using MATLAB as a fancy calculator has its own uses. It is also possible to use MATLAB as a programming language and to develop with it significant codes with considerable
More informationStructure Visualization with PyMOL
BINF 6202/ITSC 8202, Spring 2011 Structure Visualization with PyMOL February 8, 2011 Structure Visualization Why: to see the structure at different level of details + to show the structure Software: Jmol,
More informationProtein Structure and Visualization
Protein Structure and Visualization In this practical you will learn how to By Anne Mølgaard and Thomas Holberg Blicher Search the Protein Structure Databank for information. Critically choose the best
More informationProtein Crystallography
Protein Crystallography BBMB 334 Lab 4 Whitman College Program in Biochemistry, Biophysics & Molecular Biology (BBMB) Biophysics Laboratory Prof. Douglas Juers Part III. Structure Determination/Refinement
More informationCSE : Computational Issues in Molecular Biology. Lecture 7. Spring 2004
CSE 397-497: Computational Issues in Molecular Biology Lecture 7 Spring 2004-1 - CSE seminar on Monday Title: Redundancy Elimination Within Large Collections of Files Speaker: Dr. Fred Douglis (IBM T.J.
More informationStructural Informatics, Modeling, and Design with an Open-Source Molecular Software Library (MSL)
Structural Informatics, Modeling, and Design with an Open-Source Molecular Software Library (MSL) Daniel W. Kulp, [a] Sabareesh Subramaniam, [b] Jason E. Donald, [c] Brett T. Hannigan, [d] Benjamin K.
More informationQuickie PyMol Tutorial - 30 min? Stephen Curry 31 March 2006
Quickie PyMol Tutorial - 30 min? Stephen Curry 31 March 2006 What are we going to do this morning? Brief overview of the program Quick introduction to basic features Quick explanation of how to make nice
More informationGeometry Optimization Made Simple with Translation and Rotation Coordinates
Geometry Optimization Made Simple with Translation and Rotation Coordinates Lee-Ping Wang 1 and Chenchen Song 2, 3 1) Department of Chemistry, University of California; 1 Shields Ave; Davis, CA 95616.
More informationNumbers, lists and tuples. Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas
Numbers, lists and tuples Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas Numbers Python defines various types of numbers: Integer (1234) Floating point number
More informationPart 3 - Changing Colors and Display Formats
Part 3 - Changing Colors and Display Formats http://cbm.msoe.edu/newwebsite/learntomodel Introduction One of the most powerful features of Jmol is the ability to completely customize how your structure
More informationLists and the for loop
Lists and the for loop Lists Lists are an ordered collection of objects Make an empty list data = [] print data [] data.append("hello!") print data ['Hello!'] data.append(5) print data ['Hello!', 5] data.append([9,
More informationCoot Tutorial. CSHL 2006 Workshop. October 20, Mousing 2
Coot Tutorial CSHL 2006 Workshop October 20, 2006 Contents 1 Mousing 2 2 Introductory Tutorial 2 2.1 Get the files................................. 2 2.2 Start Coot................................... 2
More informationSolutions to Exercise 4 Algebraic Curve, Surface Splines IV: Molecular Models
Solutions to Exercise 4 Algebraic Curve, Surface Splines IV: Molecular Models CS384R, CAM 395T, BME 385J: Fall 2007 Question 1. Describe the LEG (Labelled Embedded Graph) atomic representations as per
More informationIntroduction to Bioinformatics. Pairwise alignments. Jacques van Helden
Introduction to Bioinformatics Pairwise alignments Jacques van Helden Jacques.van-Helden@univ-amu.fr Université d ix-marseille, France Lab. Technological dvances for Genomics and linics (TG, INSERM Unit
More informationUsing HyperChem for CH 463. Chun Park
Using HyperChem for CH 463 Chun Park Using HyperChem for CH 463 1 st Edition Written by Chun Park Oregon State University Table of Contents Introduction 1 Chapter 1 Getting Started 2 Starting HyperChem...
More informationDiscovery Studio 1.5. Online tutorial. Standalone server documentation
Discovery Studio 1.5 Online tutorial A tutorial helps you to increase your knowledge of Discovery Studio. The lessons are available for skill levels from beginning to advanced. This is a good place to
More informationGRINCH User's Manual
GRINCH User's Manual Douglas B. Schiff July 8, 1984 The University of North Carolina at Chapel Hill Department of Computer Science New West Hall 035 A Chapel Hill. N.C. 27514 Table Of Contents 1 Introduction
More informationAmino Acid Graph Representation for Efficient Safe Transfer of Multiple DNA Sequence as Pre Order Trees
International Journal of Bioinformatics and Biomedical Engineering Vol. 1, No. 3, 2015, pp. 292-299 http://www.aiscience.org/journal/ijbbe Amino Acid Graph Representation for Efficient Safe Transfer of
More informationNutrient Profile CNCPS All values except moisture are reported on a dry matter basis.
Moisture % 13.000 0.000 DM % 87.000 100.000 CF % 0.000 0.000 NDF % 15.020 17.270 ADF % 4.240 4.870 ADL % 1.610 1.850 SC % 0.000 0.000 Forage NDF % 0.000 0.000 pendf % 0.935 1.070 NFC % 15.208 17.408 Total
More informationNutrient Profile CNCPS
Moisture % 3.000 0.000 DM % 97.000 100.000 CF % 0.000 0.000 NDF % 0.000 0.000 ADF % 0.000 0.000 ADL % 0.000 0.000 SC % 0.000 0.000 Forage NDF % 0.000 0.000 pendf % 0.000 0.000 NFC % 0.000 0.000 Total CHO
More informationProtein Structure and Visualization
In this practical you will learn how to Protein Structure and Visualization By Anne Mølgaard and Thomas Holberg Blicher Search the Protein Structure Databank for information. Critically choose the best
More informationTips and Tricks using Discovery Studio
Tips and Tricks using Discovery Studio Allister J. Maynard, Ph.D. Senior Manager, R&D July 31 st, 2008 New Science and Customized Workflows for Drug Discovery Research Webinar Series June 12, 2008 - Advances
More informationFigure 2.1: Simple model of a communication system
Chapter 2 Codes In the previous chapter we examined the fundamental unit of information, the bit, and its various abstract representations: the mathematical bit, the control bit, the classical bit, and
More informationChannel. Figure 2.1: Simple model of a communication system
Chapter 2 Codes In the previous chapter we examined the fundamental unit of information, the bit, and its various abstract representations: the Boolean bit (with its associated Boolean algebra and realization
More informationUSING YOUR ALGEBRA SKILLS 2
USING YOUR ALGEBRA SKILLS 2 What would you do to get the next term in the sequence 20, 27, 34, 41, 48, 55,...? A good strategy would be to find a pattern, using inductive reasoning. Then you would look
More informationPractical 10: Protein dynamics and visualization Documentation
Practical 10: Protein dynamics and visualization Documentation Release 1.0 Oliver Beckstein March 07, 2013 CONTENTS 1 Basics of protein structure 3 2 Analyzing protein structure and topology 5 2.1 Topology
More informationresearch papers Towards complete validated models in the next 2222 doi: /s Acta Cryst. (2004). D60, 2222±
Acta Crystallographica Section D Biological Crystallography ISSN 0907-4449 Towards complete validated models in the next generation of ARP/wARP Serge X. Cohen, a Richard J. Morris, b Francisco J. Fernandez,
More informationTable S1 Comparison of CypA observed Bragg data vs. calculated from Normal Modes.
Table S1 Comparison of CypA observed Bragg data vs. calculated from Normal Modes. Resolution (Å) R-factor CC 44.560-11.070 0.5713 0.4144 11.070-8.698 0.3325 0.6957 8.697-6.834 0.2987 0.7324 6.831-5.369
More informationEurasian Coot (Fulica atra)
Eurasian Coot (Fulica atra) September 2009 Třešť Model Building with Coot Low Resolution Tools, Refinement Extensions, Hints & Tips Paul Emsley University of Oxford Stuart McNicholas Alexei Vagin Eugene
More informationGuided macro-mutation in a graded energy based genetic algorithm for protein structure prediction
Guided macro-mutation in a graded energy based genetic algorithm for protein structure prediction arxiv:1607.06113v1 [cs.ne] 7 Mar 2016 Mahmood A. Rashid a,d,, Sumaiya Iqbal b, Firas Khatib c, Md Tamjidul
More informationMolecular docking tutorial
Molecular docking tutorial Sulfonamide-type D-Glu inhibitor docked into the MurD active site using ArgusLab In this tutorial [1] you will learn how to prepare and run molecular docking calculations using
More informationDocking with GOLD. Novembre 2009 CCDC. G. Marcou, E. Kellenberger. G. Marcou, E. Kellenberger () Docking with GOLD Novembre / 25
Docking with GOLD CCDC G. Marcou, E. Kellenberger Novembre 2009 G. Marcou, E. Kellenberger () Docking with GOLD Novembre 2009 1 / 25 Sommaire 1 GOLD Suite organization 2 GOLD run setting - Wizard 3 GOLD
More informationHow To Make Your Own Kinemages
How To Make Your Own Kinemages Using KiNG and Molikin (v061020) Kinemage Construction Tutorial - Ricin Contents 1. 2. 3. 4. Kinemage 1 - a simple Cα-backbone Choosing and saving views Improving colors
More informationGPMAW for dummies. Index. 1 The sequence The toolbar Selections Coloring residues... 6
Index Chapter A Basic sequence handling 1 The sequence... 2 2 The toolbar... 3 3 Selections... 5 4 Coloring residues... 6 Chapter B Calculating mass values 1 The mass file... 7 2 Other ways of changing
More informationBIOC351: Proteins. PyMOL Laboratory #2. Objects, Distances & Images
BIOC351: Proteins PyMOL Laboratory #2 Objects, Distances & Images Version 2.1 Valid commands in PyMOL are shown in green. Exercise A: Let s fetch 1fzc, a crystallographic dimer of a fragment of human fibrinogen
More informationINTRODUCTION TO CHEMDRAW ULTRA 12.0
INTRODUCTION TO CHEMDRAW ULTRA 12.0 ITEC107 - Introduction to Computing for Pharmacy 1 Objectives Why use ChemDraw Open, view, save and close a document Exploring the user-interface and toolbars Analyzing
More informationJournal of Molecular Graphics and Modelling
Journal of Molecular Graphics and Modelling 38 (2012) 256 278 Contents lists available at SciVerse ScienceDirect Journal of Molecular Graphics and Modelling j ourna l ho me page: www.elsevier.com/locate/jmgm
More informationSupporting Information for Swellix: a Computational Tool to Explore RNA Conformational Space
Supporting Information for Swellix: a Computational Tool to Explore RNA Conformational Space Nathan Sloat, Jui-Wen Liu, Susan J. Schroeder* These authors contributed equally to this work. *Corresponding
More informationModeling framework structures. Stephen A. Wells
Modeling framework structures Stephen A. Wells Overview Frameworks, rigid units, flexibility and Rigid Unit Modes. Quantifying Rigid Unit motion in real space. - dynamic disorder in quartz. Geometric modeling
More informationMolecular Modeling Lab #1: Minimizing a Polylysine Peptide with a Molecular Mechanics Force Field
Molecular Modeling Lab #1: Minimizing a Polylysine Peptide with a Molecular Mechanics Force Field For this weeks report, include the following: 1) For each of these GROMACS file types, does the file contain
More informationAutomated phase improvement (density modification) and model building with Parrot and Buccaneer
Automated phase improvement (density modification) and model building with Parrot and Buccaneer Kevin Cowtan/Bernhard Lohkamp kevin.cowtan@york.ac.uk Bernhard.Lohkamp@ki.se X-ray structure solution pipeline...
More informationReview for Mastery Using Graphs and Tables to Solve Linear Systems
3-1 Using Graphs and Tables to Solve Linear Systems A linear system of equations is a set of two or more linear equations. To solve a linear system, find all the ordered pairs (x, y) that make both equations
More informationPrevious Year. Examination. (Original Question Paper with Answer Key) JOINT ADMISSION TEST FOR M.Sc IN IITs AND IISc
Prevus Year of Examinatn (Origina Questn Paper ith Anser Key) JOINT ADMISSION TEST FOR M.Sc IN IITs AND IISc For more questn papers, pee visit: a a INDIAN INSTITUTE OF SCIENCE BANGALORE - 560012 Prram
More informationMD-TASK Documentation. Release 1.0.1
MD-TASK Documentation Release 1.0.1 Feb 04, 2018 Getting started 1 MD-TASK 1 1.1 Contribute................................................ 1 1.2 Citing MD-TASK............................................
More informationProject 1 Solutions CS 321, Fall 2003
Project 1 Solutions CS 321, Fall 2003 Tony Faradjian The function pickca, provided on the web page, extracts the C-alpha coordinates of the several chains and places them in cells: >> r = pickca('1mhc.pdb')
More informationAdvanced Visualization with Pmv
Advanced Visualization with Pmv Michel Michel Sanner, Sanner, Ph.D. Ph.D. Graham Graham Johnson, Johnson, Ph.D. Ph.D. Ludovique Ludovique Autin, Autin, Ph.D. Ph.D. Stefano Stefano Forli, Forli, Ph.D. Ph.D.
More informationWorkshop #2: PyRosetta
Workshop #2: PyRosetta Rosetta is a suite of algorithms for biomolecular structure prediction and design. Rosetta is written in C++ and is available from www.rosettacommons.org. PyRosetta is a toolkit
More information1. Go to Structure mode. 2. From the Templates menu, choose Table of Radicals, then from the Table of Radicals window,
ACD/ChemSketch : Advanced Features and Functions ACD/ChemSketch Version 2015 Sherry Myles and Arvin Moser Advanced Chemistry Development, Inc. Toronto,, Canada www.acdlabs.com ACD/ChemSketch is a powerful
More informationBioLuminate 1.9. Quick Start Guide. Schrödinger Press
BioLuminate Quick Start Guide BioLuminate 1.9 Quick Start Guide Schrödinger Press BioLuminate Quick Start Guide Copyright 2015 Schrödinger, LLC. All rights reserved. While care has been taken in the preparation
More informationTMCH Report March February 2017
TMCH Report March 2013 - February 2017 Contents Contents 2 1 Trademark Clearinghouse global reporting 3 1.1 Number of jurisdictions for which a trademark record has been submitted for 3 2 Trademark Clearinghouse
More informationUsing Protein Data Bank and Astex Viewer to Study Protein Structure
Helsinki University of Technology S-114.500 The Basics of Cell Bio Systems 28 February 2005 Using Protein Data Bank and Astex Viewer to Study Protein Structure Teppo Valtonen ASN 50768A Contents 1.Introduction...3
More informationDensity Curve (p52) Density curve is a curve that - is always on or above the horizontal axis.
1.3 Density curves p50 Some times the overall pattern of a large number of observations is so regular that we can describe it by a smooth curve. It is easier to work with a smooth curve, because the histogram
More informationBCH 6744C: Macromolecular Structure Determination by X-ray Crystallography. Practical 5 Refinement and Structure Function Analysis
BCH 6744C: Macromolecular Structure Determination by X-ray Crystallography Practical 5 Refinement and Structure Function Analysis Introduction The ultimate goal of most structural analyses is to relate
More informationChemical Shift Perturbation Tutorial
CcpNmr Analysis Version 3 Chemical Shift Perturbation Tutorial Written by: Luca Mureddu CCPN application developer, PhD Student MCB, University of Leicester, Lancaster Road, Leicester, LE1 9HN, UK 1 t:
More informationBioinformatics III Structural Bioinformatics and Genome Analysis
Bioinformatics III Structural Bioinformatics and Genome Analysis Chapter 3 Structural Comparison and Alignment 3.1 Introduction 1. Basic algorithms review Dynamic programming Distance matrix 2. SARF2,
More informationNutrient Profile Dalex Livestock Solutions All values except moisture are reported on a dry matter basis.
INGREDIENT NUTRIENT ANALYSIS 1 Dry Matter % 95.000 2 Protein % 3 RUP (%CP). - 4 RDP (%CP). - 100.000 5 SOL (%CP). - 211 NPN %SOL (%CP) 6.1-6 NPN % 7 ME CNCPS Mcal/lb 79 NEL Level 1 Mcal/lb 8 NEL CNCPS
More information