Content. I. Definition RIS. II. How to Install RIS Service? III. Requirement RIS Service. IV. Install the Remote Installation Service

Size: px
Start display at page:

Download "Content. I. Definition RIS. II. How to Install RIS Service? III. Requirement RIS Service. IV. Install the Remote Installation Service"

Transcription

1 Content I. Definition RIS - etigvietaca RIS?... II. How to Install RIS Service? - RIS RtUv)antMeLIgkñúgeKalbMNgedIm,IGVI?... III. Requirement RIS Service - kartmelig RIS cam)ac;rtuvmangvixøh?... IV. Install the Remote Installation Service - curerobrab;bidmnak;kalnimyy²énkardmelig RIS Server? kartmelig Service RIS Server kardmelig RIS Server efvikarkmnt; Domain Controllers To Allow User to Install a Client Image using RIS Configure Server Option for Client Connect to RIS Server... V. Requirement RIS Client - eti RIS Client cam)ac;rtuvmangvixh edim,igacdmenirkar)an?... VI. kartmelig RIS enaeli Client - curerobrab;gmbirebobénkardmelig RIS Client?... Prepared by: Group 1 1

2 RIS (Remote Installation Service) I. Definition RIS - etigvietaca RIS? + RIS (Remote Installation Service) KWCa Service myyrbs; Microsoft Window 2003 Server EdlRtUv)aneKeRbIR)as;sMrab; Install OS b Application eta[ Client tamry³énkar Remote. II. How to Install RIS Service? - RIS RtUv)antMeLIgkñúgeKalbMNgedIm,IGVI? + karedleyigdmelig RIS KWkñúgeKalbMNgcg; Install OS b Application eta[ Client eday Remote tamry³ Server. III. Requirement RIS Service - kartmelig RIS cam)ac;rtuvmangvixøh? + kartmelig RIS cam)ac;rtuvman - This computer to be a member of a domain - An active DHCP and DNS server on your network - A Windows CD or a shared folder that contains the installation files - Client computer that have either a PXE boot ROM or a network adapter supported by the boot floopy IV. Install the Remote Installation Service 1- kartmelig Service RIS Server - edim,itmelig RIS Server CadMbUgeKRtÚveFVIkartMeLIg Service rbs; RIS Server Camunsin dmnak;kaldmbugrtúvcuc Start windows Control Panel Add or Remove Programe duc rubxagerkam Prepared by: Group 1 2

3 bnþab;mk Select elibakü Add/ Remove Windows Component bnþab;mk Tick elibakü Remote Installation Service bnþab;bikar Tick ryc eyigefvikarcuc Button Next Prepared by: Group 1 3

4 bnþab;mk Click Finish CakareRsc. erkam erkaybikarbb ab;ehiyenahvatamtaregayeyigefvikar Restart Machine eligvij ducrubxag RbsinebIeyIgcg;eFVIkar Restart Machine eligvijenahrtúvcuc Button Yes EtebImincg; Restart Machine eligvijetenahrtúvcuc Button No. bu:enþenaeblenheyigrtüvefvikar Restart Machine eligvij edim,iegayrbb½n rbs; Windows dmenirkarnuvgviedleyig)anefvikardmelig duecñheyigrtúvcuc Button Yes. 2- kardmelig RIS Server bnþab;mkeyignwgefvikardmelig RIS Server edayrkan;etcuc Start windows All Program Administrative Tool Remote Installation Service Setup Prepared by: Group 1 4

5 bnþab;mkvaecjpþamgmyymkegayeyigefvikarbnþ enakñúgpþamg Remote Installation Service Setup wizard eyigrtúvcuc Button Next enakñúgpþamgenheyigrtúvbmebjtitamgnigeqµahedlrtúvpþúktuk File RIS enh. cmebaheqµahdak;ya:g emþck_)an edim,igayrsylcameyigrtúvdak;eqµah RIS bnþab;mkcuc Next enhmann½yfaeyig)anefivkar Select Folder RIS enhrycmkehiy varkan;etsyrbba ak;benßmmþg etot ducenheyigcuc Button Yes edim,iefvikarbnþ Prepared by: Group 1 5

6 enakñúgpþamgenheyigrtúv Tick ykbakü Respond to client computer requesting service enakñúgpþamgenh Rtg;RbGb; Path: eyigrtúv Browse etark Folder or File rbs; Source windows EdlenA kñúgma:suinpþal; rw enakñúg CD rw TItaMgNamYy bnþab;mkcuc Next Prepared by: Group 1 6

7 enakñúgrbgb; Folder Name eyigrtúvbmebjeqµahrbs; Folder EdleFVIkarrkSaTuknUv Source rbs; Windows bnþab;mkcuc Next enakñúgrbgb;enheyigmincam)ac;efvikargvitamggs; bnþab;mkcuc Next pþamgenhrkan;etbb ak;r)ab;egayeyigdwggmbigviedleyigefvikarbmebjbimunmk bnab;mkcuc Finish edim,iegayvaefvikarbnþ Prepared by: Group 1 7

8 bnþab;mkcucbakü Done. 3- efvikarkmnt; Domain Controllers edim,iefvikarkmnt; Domain Controllers dmbugrtúvcuc enakñúgpþamg Active Directory User and Computers eyigefivkar Select eli Domain Controllers Prepared by: Group 1 8

9 bnþab;mkefvikar Right Click enaelibakü PCHOME (PCHOME KWCaeQµaH Computer Server) ehiyykbakü Properties bnþab;mk Select Tap Remote Install bnþab;mkcucbakü Advanced Settings Prepared by: Group 1 9

10 enakñúgpþamgenheyigefvikarerciserisykbakü Custom enaeblenahvalicecjpþamg Computer Account Generation bnþab;mkvaybakü PC%# (karvaybakü PC%# efviegaygayrsyldl;kumbüút½r Client TaMgGs; enaebledlefvikar Install Windows EdlTag Source tam ry³ Network edayeyigmincam)ac;eta kmnt;eqµahrbs; PC nimyy² KWmann½yfavart; Automatic edayxøünég EdlcaMepþImeLIgBakü PC ehiy nwgcmnynelxrbs; PC).Example : PC1, PC2, PC3... ehiycucbakü OK bnþab;mkcuc Button Apply and Button Ok Prepared by: Group 1 10

11 Click Button Ok for Finish. enaebledleyigefvikarkmnt;rycehiyenah kumepøcefivkar Restart RIS Service edaycureta Command Prompt KWcuc Start Windows Key + R or Start Windows Run bnþab;mkvaybakü cmd and Ok enakñúgpþamg Command Prompt Prepared by: Group 1 11

12 enaeblenheyigvaybakü net stop binlsvc and net start binlsvc 4- To Allow User to Install a Client Image using RIS dmbugeyigrtúvculetakan; Active Directory Users and Computers bnþab;mkvaecjpþamg Active Directory User and Computer enakñúgpþamgenhsum Right Click eli Domain rbs;eyig ehiyykbakü Delegate Control Please Click Button Next Prepared by: Group 1 12

13 enakñúgpþamg Delegation of Control Wizard sumcuc Button Add bnþab;mkcuc Button Advanced enakñúgpþamgenhsumcuc Button Find Now ehiyerciserisykbakü Everyonc ehiycuc Button Ok Prepared by: Group 1 13

14 Click Button OK Click Button Next enakñúgpþamgenhrtúvefvikarerciseris Option Delegate the following common tasks ehiy Tick elibakü Join a computer to the domain bnþab;mk Click Button Next Prepared by: Group 1 14

15 enaeblenh user TaMgGs;GaceRbI RIS smrab;efvikar Install an OS image. 5- Configure Server Option for Client Connect to RIS Server enaeblenahrtúvculetakan; DHCP tamkarcuc Start Windows Administrative Tools DHCP All Program bnþab;mkvanwgelatecjpþamg DHCP mk bnþab;mk Right Click elibakü Server Option ehiyykbakü Configure Option Prepared by: Group 1 15

16 bnþab;mkerciserisykbakü 066 Boot Server Host Name edayefvikar Tick ykvaetmþg ehiy enakñúgrbgb; String Value RtÚvvaeQµaH Server rbs;eyig (KWeQµaHkuMBüÚT½r server). bnþab;mketoterciserisykbakü 067 Boot File Name ehiyenakñúgrbgb; String Value sumvaybakü OSChooser\i386\startrom.com bnþab;mk Click Button Apply and Button OK Prepared by: Group 1 16

17 enakñúgrubpabxagelieyigfa DHCP xageqvg enaelibakü Server Option eyigexijman 2 File 066 Boot Server Host Name & 067 Boot File Name. enaeblenahrubpab DHCP xagsþam enaelibakü Scope Option k_)anbegáit File 2 edayxøünég duc etanwg Server Option EdlKW 066 Boot Server Host Name & 067 Boot File Name. V. Requirement RIS Client - eti RIS Client cam)ac;rtuvmangvixh edim,igacdmenirkar)an? + edim,i[ RIS Client GacdMeNIrkar)aneyIgcaM)ac;RtUvman Network On Board or Network Card Edlman File Boot PXE. PXE CaRbePT Network EdlGac Boot tamry³ Network )an. VI. kartmelig RIS enaeli Client - curerobrab;gmbirebobénkardmelig RIS Client? + edim,igacdmenirkar)an RIS Client cmebah Client cam)ac;rtúvman Network Onboard or Network Card EdlGac Boot tamry³ Network )an (mann½y Netwrok RtÚvEtmanRbePTCa PXE) ehiyculetaekregayva Boot tamry³ Network edayculetakan; BIOS enakñúg BIOS eyigekrvaegay Boot ehiyykbakü Network Boot From... bnþab;mkefvikar cakecjedaycuc F10 Key ehiy Enter enaelibakü Yes enaeblenahvanwg Restart Machine ehiybnþab;mketoteyigrtuvcuc Enter rycvanwgecjrubpabducxagenh Prepared by: Group 1 17

18 bnþab;mkeyignwgexijva Boot tamry³ DHCP... RbsinebIeyIgeXIjBakü Operating System Not Found mann½yfavarkminexij pþúyetavijrbsinebiexijbakü Press F12 For Network Service Boot Click Button Enter (Continue) bmebj User name nig Password ehiy Click Button Enter (Continue) Prepared by: Group 1 18

19 + Click Button Enter (Continue) + Click Button Enter (Continue) ebledleyigcuc Enter rycvanwgecjrubducxagelienhmann½yfaeyigecakc½ykñúgkarefvikaregay Boot tamry³ Network )ansmerc KWva)anrkeXIj Operating System enaeli Server.. cb; Prepared by: Group 1 19

Setting up a RIS (Remote Installation Service) server (Windows Server 2003 SP 1) Updated February 13 th, 2008.

Setting up a RIS (Remote Installation Service) server (Windows Server 2003 SP 1) Updated February 13 th, 2008. Setting up a RIS (Remote Installation Service) server (Windows Server 2003 SP 1) Updated February 13 th, 2008. The most up to date version of this document can be found at the following link http://www.windows-noob.com/forums/index.php?showtopic=66

More information

muldæanenakñúgkarcysculkumbüút½r

muldæanenakñúgkarcysculkumbüút½r emeronti1 muldæanenakñúgkarcysculkumbüút½r I- Hard Ware : KWCaEpñkrwg EdleyIgGacemIleXIjehIynigb:H)an EdlmandUcCa³ Printer, Scanner, Key board, Mouse, Monitor, CPU, Ram, Hard disk, CD-Rom, Case, Power

More information

AOMEI Image Deploy User Manual

AOMEI Image Deploy User Manual AOMEI Image Deploy User Manual AOMEI Image Deploy Overview Sometimes we need to deploy/restore Windows image files to multiple computers or clone system disk to multiple computers in a same LAN to install

More information

Automating the Windows 2000 Installation

Automating the Windows 2000 Installation Chapter 2 Automating the Windows 2000 Installation MICROSOFT EXAM OBJECTIVES COVERED IN THIS CHAPTER Perform an unattended installation of Windows 2000 Professional. Install Windows 2000 Professional by

More information

UEFI PXE Server. Windows Server 2012 S.O.P.

UEFI PXE Server. Windows Server 2012 S.O.P. UEFI PXE Server Windows Server 2012 S.O.P. 1 Directory (1)Install.Net Framework 3.5.1...3 (2) AD DS/DNS installation and configuration...6 (3) DHCP installation and configuration...16 (4)WDS Configuration

More information

CMBUkTI4 XøaepÞógpÞat;lkçx½NÐ 3

CMBUkTI4 XøaepÞógpÞat;lkçx½NÐ 3 JAVA Programming - 33 - ChapterIV CMBUkTI4 XøaepÞógpÞat;lkçx½NÐ 3 XøaepÞógpÞat;lkçx½NÐenAkñúgPasa Java RtUv)anerobdak;eTAtamRbePTdUcCa³ Selection, Iteration nig Jump. XøaRbePT Selection GaceGaykmμviFIrbs;eyIgeRCIsyknUvtMeNIrRbtibtþikarepSgKña

More information

VIRTUALIZATION MANAGER ENTERPRISE EDITION GETTING STARTED GUIDE. Product: Virtual Iron Virtualization Manager Version: 4.2

VIRTUALIZATION MANAGER ENTERPRISE EDITION GETTING STARTED GUIDE. Product: Virtual Iron Virtualization Manager Version: 4.2 VIRTUALIZATION MANAGER ENTERPRISE EDITION GETTING STARTED GUIDE This manual provides a quick introduction to Virtual Iron software, and explains how to use Virtual Iron Virtualization Manager to configure

More information

Deploying Windows 7 Using MDT UDI

Deploying Windows 7 Using MDT UDI The Microsoft Deployment Toolkit (MDT) supports three types of deployments Zero Touch Installation (ZTI), Lite Touch Installation (LTI), and User Driven Installation (UDI). However each deployment type

More information

RIS Installation Steps

RIS Installation Steps RIS Installation Steps The basic steps for installing a RIS server are as follows: Install Windows 2003 Server Install Remote Installation Services Run the Remote Installation Services Setup Wizard Authorise

More information

CMBUkTI2 RbePTTinñn½y/ GBaØatþi/ nig Arrays 3

CMBUkTI2 RbePTTinñn½y/ GBaØatþi/ nig Arrays 3 JAVA Programming - 6 - ChapterII CMBUkTI2 RbePTTinñn½y/ GBaØatþi/ nig Arrays 3 Java KWCaPasamanlkçN³kMNt;RbePTTinñn½yc,as;las;. ktþaenhehiykwca EpñkmYyrbs; Java EdleFVIeGaymanPaBrwgmaM nigmansuvtßipab.

More information

Getting Started with the Deployment Console and Deploying the Clients Per PXE Network Booting using their MAC address. Quick Guide

Getting Started with the Deployment Console and Deploying the Clients Per PXE Network Booting using their MAC address. Quick Guide Getting Started with the Deployment Console and Deploying the Clients Per PXE Network Booting using their MAC address Quick Guide Deployment Manager 2 Quick Guide 1 Introduction...3 1.1 Installing the

More information

Lenovo Imaging Checklist

Lenovo Imaging Checklist *Note: If this is a re-image, it s recommended getting into setup and clearing the Security Chip. PRE-INSTALLATION BIOS (When powering up, hit F1 at the Lenovo Logo screen) For all Lenovo Laptop models:

More information

VMWare Workstation Installation. Microsoft Windows Server 2008 Enterprise with Service Pack 2

VMWare Workstation Installation. Microsoft Windows Server 2008 Enterprise with Service Pack 2 VMWare Workstation Installation Microsoft Windows Server 2008 Enterprise with Service Pack 2 Starting Vmware Workstation Go to start menu and start VMware Workstation program. *Note: The following instructions

More information

How to install the software of ZNS8022

How to install the software of ZNS8022 How to install the software of ZNS8022 1. Please connect ZNS8022 to your PC after finished assembly. 2. Insert Installation CD to your CD-ROM drive and initiate the auto-run program. The wizard will run

More information

Getting Started with Deployment Console to Deploy Clients per PXE using MAC Address Identification

Getting Started with Deployment Console to Deploy Clients per PXE using MAC Address Identification PARAGON Technologie GmbH, Systemprogrammierung Heinrich-von-Stephan-Str. 5c 79100 Freiburg, Germany Tel. +49 (0) 761 59018201 Fax +49 (0) 761 59018130 Internet www.paragon-software.com E-mail sales@paragon-software.com

More information

Version S Cincinnati, Suite 105 Tulsa, OK (918) Fax (918)

Version S Cincinnati, Suite 105 Tulsa, OK (918) Fax (918) Version 1.0 We pride ourselves in producing good stuff. If you have any questions, problems, or suggestions regarding this product, please contact us at: 810 S Cincinnati, Suite 105 Tulsa, OK 74119 (918)

More information

Before inserting the card and drivers, you need to install DirectX 9.0c. This is available on the installation CD included with your product.

Before inserting the card and drivers, you need to install DirectX 9.0c. This is available on the installation CD included with your product. I. DirectX Driver Installation Before inserting the card and drivers, you need to install DirectX 9.0c. This is available on the installation CD included with your product. 1. Insert the CD into your CD-ROM

More information

New Cash Register System Quick Setup Guide. Version: XP1.0

New Cash Register System Quick Setup Guide. Version: XP1.0 New Cash Register System Quick Setup Guide Version: XP1.0 Contents Quick Step 1 - Upload New Cash Register System End User License... 1 Quick Step 2 Retrieve MAC IDs... 1 Quick Step 3 - Add License Key

More information

Application Notes for Ardence Desktop Edition with Avaya Interaction Center Issue 1.0

Application Notes for Ardence Desktop Edition with Avaya Interaction Center Issue 1.0 . Avaya Solution & Interoperability Test Lab Application Notes for Ardence Desktop Edition with Avaya Interaction Center Issue 1.0 Abstract These Application Notes describe the configuration steps required

More information

Windows Server 2003 { Domain Controller Installation and Configuration}

Windows Server 2003 { Domain Controller Installation and Configuration} Windows Server 2003 { Domain Controller Installation and } Benedikt Riedel MCSE + Messaging www.go-unified.com www.siemens.com/open Benedikt.riedel@siemens.com Start up the prepared Windows Server 2003

More information

LPR for Windows 95/98/Me/2000 TCP/IP Printing User s Guide

LPR for Windows 95/98/Me/2000 TCP/IP Printing User s Guide LPR for Windows 95/98/Me/2000 TCP/IP Printing User s Guide Rev. 02 (August, 2001) Copyright Statement Trademarks Copyright 1997 No part of this publication may be reproduced in any form or by any means

More information

CMBUkTI3 sbaøannbvnþelx 3

CMBUkTI3 sbaøannbvnþelx 3 JAVA Programming - 21 - ChapterIII CMBUkTI3 sbaøannbvnþelx 3 1> sbaøannbvnþelxknit(arithmetic operators): sbaøannbvnþelxknit RtUv)aneRbIenAkñúgkenSamelxKNitvITüa EdldUceTAnwgkareRbIenAkñúg BiCKNitEdr.

More information

INSTALLATION GUIDE FOR MICROSOFT S SQL SERVER 2005 DATABASE SERVER SOFTWARE

INSTALLATION GUIDE FOR MICROSOFT S SQL SERVER 2005 DATABASE SERVER SOFTWARE Page 1 INSTALLATION GUIDE FOR MICROSOFT S SQL SERVER 2005 DATABASE SERVER SOFTWARE This chapter of the Product Kit is designed to specifically provide you with complete installation instructions when installing

More information

Practice and Review Activities Software

Practice and Review Activities Software Practice and Review Activities Software Installation and Setup Procedure Reading Mastery Signature Edition Corrective Reading Installation Insert the Practice and Review Activities CD-ROM into the CD/DVD

More information

SWP-0036 AFHCAN Telehealth Cart Imaging and Software Configuration. Revision: 1. Effective Date: 1/4/2011

SWP-0036 AFHCAN Telehealth Cart Imaging and Software Configuration. Revision: 1. Effective Date: 1/4/2011 Software Procedure SWP-0036 AFHCAN Telehealth Cart Imaging and Software Configuration Revision: 1 Effective Date: 1/4/2011 Alaska Native Tribal Health Consortium Division of Health Information & Technology

More information

Farstone TotalDeploy User Guide

Farstone TotalDeploy User Guide Farstone TotalDeploy User Guide 1 Introduction to TotalDeploy...3 1.1 Overview...3 1.1.1 What is TotalDeploy...3 1.1.2 Who needs TotalDeploy?...3 1.1.3 TotalDeploy infrastructure...3 1.2 What you can do

More information

Deploying Microsoft Windows Compute Cluster Server 2003

Deploying Microsoft Windows Compute Cluster Server 2003 Deploying Microsoft Windows Compute Cluster Server 2003 on Dell PowerEdge Servers Microsoft Windows Compute Cluster Server 2003 (CCS) can help provide a simple, cost-effective way to deploy and manage

More information

CD-ROM Image Viewer Installation Guide M&T Bank. Member FDIC.

CD-ROM Image Viewer Installation Guide M&T Bank. Member FDIC. CD-ROM Image Viewer CD ROM Image Viewer Installation User Guide Introduction M&T Bank has upgraded your CD ROM Image Viewer software. The upgrade provides a higher level of security to help protect your

More information

NET-DYN USB Dual Band (Mediatek) Installation Guide. This manual is divided into three parts: Windows XP, Windows 7 / 8 / 8.

NET-DYN USB Dual Band (Mediatek) Installation Guide. This manual is divided into three parts: Windows XP, Windows 7 / 8 / 8. Installation Guide NET-DYN USB Dual Band (Mediatek) Installation Guide This manual is divided into three parts: Windows XP, Windows 7 / 8 / 8.1 /10, and Mac 1.Windows XP Please do the following steps to

More information

VI-CENTER EXTENDED ENTERPRISE EDITION GETTING STARTED GUIDE. Version: 4.5

VI-CENTER EXTENDED ENTERPRISE EDITION GETTING STARTED GUIDE. Version: 4.5 VI-CENTER EXTENDED ENTERPRISE EDITION GETTING STARTED GUIDE This manual provides a quick introduction to Virtual Iron software, and explains how to use Virtual Iron VI-Center to configure and manage virtual

More information

Dell Flexible Computing Solutions: Deploying On-Demand Desktop Streaming

Dell Flexible Computing Solutions: Deploying On-Demand Desktop Streaming Dell Flexible Computing Solutions: Deploying On-Demand Desktop Streaming Product Group November 2007 Dell White Paper November 2007 Contents Introduction... 3 Overview... 4 Planning the Deployment... 5

More information

ThinkVantage Fingerprint Software

ThinkVantage Fingerprint Software ThinkVantage Fingerprint Software 12 2 1First Edition (November 2005) Copyright Lenovo 2005. Portions Copyright International Business Machines Corporation 2005. All rights reserved. U.S. GOVERNMENT

More information

EventTracker: Virtual Appliance

EventTracker: Virtual Appliance EventTracker: Virtual Appliance Quick Start Guide Version 8.1 Build 9 Publication Date: Feb. 8, 2016 EventTracker 8815 Centre Park Drive Columbia MD 21045 www.eventtracker.com Abstract The EventTracker

More information

QLogic iscsi Adapter SCSI Stor Miniport Driver for Windows Server 2003/XP. Table of Contents

QLogic iscsi Adapter SCSI Stor Miniport Driver for Windows Server 2003/XP. Table of Contents QLogic iscsi Adapter SCSI Stor Miniport Driver for Windows Server 2003/XP This software license applies only to QLogic customers. QLogic Corporation. All rights reserved. Table of Contents 1. OS Support

More information

FUJITSU Cloud Service S5 Exporting a Windows 2008 VM

FUJITSU Cloud Service S5 Exporting a Windows 2008 VM FUJITSU Cloud Service S5 Exporting a Windows 2008 VM The following guide describes the process for exporting a Windows 2008 virtual machine from the FUJITSU Cloud Service S5 and importing it into a virtualized

More information

Using UCS-Server Configuration Utility

Using UCS-Server Configuration Utility CHAPTER 3 This chapter contains the following sections: UCS-SCU Interface, page 3-1 Get System Updates, page 3-3 Configure a Server, page 3-5 RAID Configuration, page 3-5 OS Installation, page 3-8 Save

More information

1) Installing Bluetooth software for Windows (A) Place installation CD into PC and setup should launch automatically.

1) Installing Bluetooth software for Windows (A) Place installation CD into PC and setup should launch automatically. 1) Installing Bluetooth software for Windows (A) Place installation CD into PC and setup should launch automatically. If setup does not launch, use Windows Explorer to navigate to the appropriate CD- ROM

More information

EventTracker: Virtual Appliance

EventTracker: Virtual Appliance Quick Start Guide Version 7.6 Publication Date: Sep 18, 2014 EventTracker 8815 Centre Park Drive Columbia MD 21045 www.eventtracker.com Abstract The EventTracker Virtual Appliance enables you to capture

More information

As the system boots press Shift and F10 to enter the DASH Setup.

As the system boots press Shift and F10 to enter the DASH Setup. The following guide explains how to setup and use the DASH enabled Pegatron IPMSB-DA with SyAM Software, System Client and System Area Manager for performing the DASH out of band management functions.

More information

SAS Installation Instructions Windows 2003, XP, 2000, NT. Workstation Installation Guidelines

SAS Installation Instructions Windows 2003, XP, 2000, NT. Workstation Installation Guidelines UCit Instructional and Research Computing, Software Distribution Office, 303B Zimmer Hall, Cincinnati, OH 45221-0088. Phone: (513) 556 9068 Email: Software@uc.edu SAS 9.1.3 Installation Instructions Windows

More information

Reset the Admin Password with the ExtraHop Rescue CD

Reset the Admin Password with the ExtraHop Rescue CD Reset the Admin Password with the ExtraHop Rescue CD Published: 2018-01-19 This guide explains how to reset the administration password on physical and virtual ExtraHop appliances with the ExtraHop Rescue

More information

TS: Windows 7 and Office 2010, Deploying

TS: Windows 7 and Office 2010, Deploying 70-681 TS: Windows 7 and Office 2010, Deploying Version 3.1 QUESTION NO: 1 Windows Server 2008 R2. You install Microsoft Deployment Toolkit (MDT) 2010 on a server named Server1. You install Microsoft SQL

More information

Windows NT Server Printer Driver Upgrade Instructions

Windows NT Server Printer Driver Upgrade Instructions Windows NT Server Printer Driver Upgrade Instructions The steps detailed below describe the most reliable method to upgrade printer driver versions after v1.6.0227a on a Windows NT 4.0 Server that is shared

More information

How To Make A Pen-Drive Bootable?

How To Make A Pen-Drive Bootable? How To Make A Pen-Drive Bootable? Hello Friends Welcome to FixinGeek.com How are you, friends? I m back after a long time so friends in this post you will learn the process to make your pen drive bootable

More information

Understanding UCS Server Configuration Utility User Interface

Understanding UCS Server Configuration Utility User Interface CHAPTER 3 Understanding UCS Server Configuration Utility User Interface The UCS-SCU GUI is a web-based management interface that allows you to perform tasks such as operating system installation, RAID

More information

Congratulations on purchasing Hawking s HWPS12UG 1-Port Parallel + 2 USB Ports Wireless G Print Server. The Hawking HWPS12UG is a powerful and

Congratulations on purchasing Hawking s HWPS12UG 1-Port Parallel + 2 USB Ports Wireless G Print Server. The Hawking HWPS12UG is a powerful and Congratulations on purchasing Hawking s HWPS12UG 1-Port Parallel + 2 USB Ports Wireless G Print Server. The Hawking HWPS12UG is a powerful and convenient network printing solution that will connect your

More information

NEC PowerMate 2000 Series Release Notes. Contents

NEC PowerMate 2000 Series Release Notes. Contents NEC PowerMate 2000 Series Release Notes Contents Applications... 3 Installing Applications in the Correct Order... 3 Installing NEC SNMP Agent... 3 Uninstalling the NEC SNMP Agent or LANDesk Client Manager...

More information

VERTECH. VERTECH Central Station Software Installation Manual

VERTECH. VERTECH Central Station Software Installation Manual VERTECH Central Station Software Installation Manual Installation Manual July 2006 1 Table of Contents 1.0 Introduction... 3 2.0 Vertx Access Control System 1.0 Installation Guide... 3 3.0 Vertx Access

More information

Topcat. Installation Guide. Version 1.03

Topcat. Installation Guide. Version 1.03 Microlynx Software Engineering Topcat Installation Guide Version 1.03 1998 Microlynx Software Engineering ii Copyright 1998 Microlynx Software Engineering Neither the whole nor any part of the information

More information

Lesson 1: Preparing for Installation

Lesson 1: Preparing for Installation 2-2 Chapter 2 Installing Windows XP Professional Lesson 1: Preparing for Installation When you install Windows XP Professional, the Windows XP Professional Setup program allows you to specify how to install

More information

Dell Wyse Windows 10 IoT Enterprise for Latitude 3480 mobile thin client. BIOS upgrade guide

Dell Wyse Windows 10 IoT Enterprise for Latitude 3480 mobile thin client. BIOS upgrade guide Dell Wyse Windows 10 IoT Enterprise for Latitude 3480 mobile thin client BIOS upgrade guide Notes, cautions, and warnings NOTE: A NOTE indicates important information that helps you make better use of

More information

EDS8/16/32PR Quick Start Guide

EDS8/16/32PR Quick Start Guide Quick Start Guide 2007 Copyright Lantronix is a trademark of Lantronix. All rights reserved. 900-458 Rev. B 01/07 QUICK START GUIDE CONTENTS What s In the Box..........................................................2

More information

Lab: Advanced Installation of Windows XP. Introduction

Lab: Advanced Installation of Windows XP. Introduction 12.2.2 Lab: Advanced Installation of Windows XP Introduction Print and complete this lab. In this lab, you will install a Windows XP operating system by using an answer file for automation. You will customize

More information

USB PRINTER WIRELESS LAN PRINT SERVER (DN-13014) PARALLEL PRINTER WIRELESS LAN PRINT SERVER (DN-13016) Quick Installation Guide

USB PRINTER WIRELESS LAN PRINT SERVER (DN-13014) PARALLEL PRINTER WIRELESS LAN PRINT SERVER (DN-13016) Quick Installation Guide USB PRINTER WIRELESS LAN PRINT SERVER (DN-13014) PARALLEL PRINTER WIRELESS LAN PRINT SERVER (DN-13016) Quick Installation Guide 1 1.1 Product Introduction Thank you for purchasing and using our print server.

More information

Fujitsu Global Cloud Platform Exporting a Windows 2003 / 2008 VM

Fujitsu Global Cloud Platform Exporting a Windows 2003 / 2008 VM Fujitsu Global Cloud Platform Exporting a Windows 2003 / 2008 VM The following guide describes the process for exporting a Windows 2003 / 2008 virtual machine from the Global Cloud platform and importing

More information

Windows 7 Professional 64 bit Installation and Configuration for MassLynx or Empower Controlled Ethernet Instrument Communication

Windows 7 Professional 64 bit Installation and Configuration for MassLynx or Empower Controlled Ethernet Instrument Communication Windows 7 Professional 64 bit Installation and Configuration for MassLynx or Empower Controlled Ethernet Instrument Communication May 2014 Version 4 PLEASE READ BEFORE CONTINUING: This document applies

More information

AMD Ryzen Threadripper NVMe RAID Quick Start Guide RC Release Version 1.0

AMD Ryzen Threadripper NVMe RAID Quick Start Guide RC Release Version 1.0 AMD Ryzen Threadripper NVMe RAID Quick Start Guide RC-9.1.0 Release Version 1.0 1 P a g e Contents 1 GENERAL INFORMATION... 3 1.1 Purpose... 3 1.2 System requirements... 3 1.3 Information about supported

More information

USB2.0 IDE & LANDISK External Enclosure

USB2.0 IDE & LANDISK External Enclosure USB2.0 IDE & LANDISK External Enclosure CONTENT User s Manual 1. Product Information.....................1 2. Product Specifications....................2 3. System requirements....................3 4.

More information

Installing Active Directory on a Windows 2008 Server

Installing Active Directory on a Windows 2008 Server Installing Active Directory on a Windows 2008 Server May 14, 2012 Copyright 2012 by World Class CAD, LLC. All Rights Reserved. Server 2008 Desktop To start the process of making a Domain Controller, we

More information

The Firmware Update is a tool that easily updates the embedded components on your FTB-1.

The Firmware Update is a tool that easily updates the embedded components on your FTB-1. FTB-1 Introduction The is a tool that easily updates the embedded components on your FTB-1. Note: The tool replaces the old Embedded Software Updater (ESU). Release History This release of includes the

More information

SCCM 2012 How To Instructions

SCCM 2012 How To Instructions SCCM 2012 How To Instructions For an online copy and the most current version go to: http://www2.leon.k12.fl.us/sites/techcentral/training/sccm/default.aspx Leon County Schools SCCM 2012 Doc v1.2 Table

More information

Courseworks 10 Network Installation - 1 Seat

Courseworks 10 Network Installation - 1 Seat Courseworks 10 Network Installation - 1 Seat A complete User s Guide is located on your Courseworks 10 CD (in the Paulson folder) in.pdf format. In order to fully understand how to set up your training,

More information

Managing Windows-based Dell Wyse Thin Clients using System Center Configuration Manager Administrator s Guide

Managing Windows-based Dell Wyse Thin Clients using System Center Configuration Manager Administrator s Guide Managing Windows-based Dell Wyse Thin Clients using System Center Configuration Manager 2016 Administrator s Guide Notes, cautions, and warnings NOTE: A NOTE indicates important information that helps

More information

VIRTUALIZATION MANAGER ENTERPRISE EDITION GETTING STARTED GUIDE

VIRTUALIZATION MANAGER ENTERPRISE EDITION GETTING STARTED GUIDE VIRTUALIZATION MANAGER ENTERPRISE EDITION GETTING STARTED GUIDE This manual provides a quick introduction to Virtual Iron software, and explains how to use Virtual Iron Virtualization Manager to configure

More information

What you need to run Custrack. This program will allow the user to:

What you need to run Custrack. This program will allow the user to: Welcome to the Custrack Business Management System - Responding to a growing need in the direct marketing industry, Custrack was designed to assist a company in all aspects of database manipulation, marketing

More information

EventTracker: Virtual Appliance

EventTracker: Virtual Appliance Quick Start Guide Version 7.5 Publication Date: Nov 18, 2013 EventTracker 8815 Centre Park Drive Columbia MD 21045 www.eventtracker.com About This Guide Abstract The EventTracker Virtual Appliance enables

More information

PrintView for Oki Installation and Quick Setup

PrintView for Oki Installation and Quick Setup PrintView for Oki Installation and Quick Setup This booklet covers the basics of getting PrintView up and running. It explains how to install the software, how to add printers to the system, and how to

More information

FUJITSU Cloud Service S5 Exporting a Windows Server VM

FUJITSU Cloud Service S5 Exporting a Windows Server VM FUJITSU Cloud Service S5 Exporting a Windows Server VM The following guide describes the process of exporting a Windows 2008 or 2012 virtual machine from the FUJITSU Cloud Service S5 platform and importing

More information

Sound Card Installation for Windows 95/98

Sound Card Installation for Windows 95/98 Sound Card Installation for Windows 95/98 Hardware Installation 1. Shut down Windows and power down system. Unplug power cable from the system. 2. Remove screws and open system enclosure. 3. Remove static

More information

8.9.2 Lab: Configure an Ethernet NIC to use DHCP in Windows Vista

8.9.2 Lab: Configure an Ethernet NIC to use DHCP in Windows Vista 8.9.2 Lab: Configure an Ethernet NIC to use DHCP in Windows Vista Introduction If Vista is not available in your classroom, you may complete this lab by viewing the figures in this document. Print and

More information

Marvell SATA3 RAID Installation Guide

Marvell SATA3 RAID Installation Guide Marvell SATA3 RAID Installation Guide Overview The Marvell RAID Utility (MRU) is a browser-based graphical user interface (GUI) tool for the Marvell RAID adapter. It supports IO Controllers (IOC) and RAID-On-Chip

More information

Browser Client 4.0 Admin Guide

Browser Client 4.0 Admin Guide Browser Client is a web-based application that allows users to point their browser at a URL and view live video from a set of Intellex units. Browser Client 4.0 is compatible with Intellex 3.2 and 4.0

More information

Network Planning and Implementation

Network Planning and Implementation Network Planning and Implementation SYLLABUS 3.1 Designing network 3.1.1 Accessing network needs- applications, users, network services, security and safety, growth and capacity planning 3.1.2 Meeting

More information

Bridge Cable User s Guide

Bridge Cable User s Guide Bridge Cable User s Guide Table of Contents Overview -------------------------------------------------------------------- 2 Driver Installation --------------------------------------------------------

More information

ThinkVantage Fingerprint Software

ThinkVantage Fingerprint Software ThinkVantage Fingerprint Software 12 2 1First Edition (February 2006) Copyright Lenovo 2006. Portions Copyright International Business Machines Corporation 2006. All rights reserved. U.S. GOVERNMENT

More information

Installing HostExplorer 10 For the PC Author: Byron Watanabe

Installing HostExplorer 10 For the PC Author: Byron Watanabe WIN1013 July 2005 Installing HostExplorer 10 For the PC Author: Byron Watanabe Requirements Requirements... 1 Obtaining HostExplorer... 1 Preparing to install... 1 Installation... 2 HostExplorer 10.0 supports

More information

Managing DFS Replication: Directories & Replicated Files

Managing DFS Replication: Directories & Replicated Files Managing DFS Replication: Directories & Replicated Files Instructions on how to setup, remove and manage directories within DFSR. Author: John Wieda, MCTS: SCOM, SCCM, SCVMM SystemCenterSpartan.wordpress.com

More information

This is a GENERAL Servant Keeper Network Installation help sheet. If you need further assistance, please contact your network administrator.

This is a GENERAL Servant Keeper Network Installation help sheet. If you need further assistance, please contact your network administrator. SK Help Network Help Sheets - Workstation Installation This is a GENERAL Servant Keeper Network Installation help sheet. If you need further assistance, please contact your network administrator. Due to

More information

Windows 10 First Login Guide (Laptops) Version 1.0

Windows 10 First Login Guide (Laptops) Version 1.0 31T Uhttp://onedrive.lboro.ac.ukU31T. Windows 10 First Login Guide (Laptops) Version 1.0 Introduction The first time you login to any Windows 10 PC you will see several messages and boxes. This guide will

More information

Cisco UCS C-Series. Installation Guide

Cisco UCS C-Series. Installation Guide Installation Guide UPDATED: 04 October 2018 Copyright Notices Copyright 2002-2018 KEMP Technologies, Inc. All rights reserved. KEMP Technologies and the KEMP Technologies logo are registered trademarks

More information

Lab Install Windows 8

Lab Install Windows 8 Introduction In this lab, you will install Windows 8.1 and 8.0. Recommended Equipment A computer with a blank hard disk drive Windows 8.1 and 8.0 installation DVD or USB flash drive Step 1: Starting the

More information

Digidoc Icon Camera Installation

Digidoc Icon Camera Installation Digidoc Icon Camera Installation 1. Insert the Icon Camera CD. Do not run anything from the cd until prompted. 2. Plug in the Icon Camera into a USB 2.0 port. This port MUST be 2.0. The PC will find the

More information

SyncToy - Automated Schedule

SyncToy - Automated Schedule SyncToy - Automated Schedule While SyncToy does not have a built-in option to run on an automated schedule, the Scheduled Tasks tool in Windows can be used to launch the SyncToy application on a set schedule.

More information

S/MIME on Good for Enterprise MS Online Certificate Status Protocol. Installation and Configuration Notes. Updated: November 10, 2011

S/MIME on Good for Enterprise MS Online Certificate Status Protocol. Installation and Configuration Notes. Updated: November 10, 2011 S/MIME on Good for Enterprise MS Online Certificate Status Protocol Installation and Configuration Notes Updated: November 10, 2011 Installing the Online Responder service... 1 Preparing the environment...

More information

Dell EqualLogic Red Hat Enterprise Linux 6.2 Boot from SAN

Dell EqualLogic Red Hat Enterprise Linux 6.2 Boot from SAN Dell EqualLogic Red Hat Enterprise Linux 6.2 Boot from SAN A Dell EqualLogic best practices technical white paper Storage Infrastructure and Solutions Engineering Dell Product Group November 2012 2012

More information

AMD RAID Installation Guide

AMD RAID Installation Guide AMD RAID Installation Guide 1. AMD BIOS RAID Installation Guide... 2 1.1 Introduction to RAID... 2 1.2 RAID Configurations Precautions... 4 1.3 Legacy RAID ROM Configuration (for AMD X370, B350, and A320

More information

Technical Guide to Remote Installation Services

Technical Guide to Remote Installation Services Technical Guide to Remote Installation Services Topics on this Page Introduction RIS Client/Server Components Pre-Boot Execution Environment (PXE) Installing RIS Remote Install Directory Structure Deployment

More information

Installing and Using Document Distributor

Installing and Using Document Distributor To view or download this or other Lexmark Document Solutions publications, click here. Installing and Using Document Distributor The Lexmark Document Distributor consists of server and client software

More information

Check Your Package Contents These are the items included with your purchase: DFE-690TXD 32-Bit Cardbus Fast Ethernet Adapter

Check Your Package Contents These are the items included with your purchase: DFE-690TXD 32-Bit Cardbus Fast Ethernet Adapter This product can be used with: Windows XP, 2000, Me, 98se & 98 Macintosh OS v 8 & 9 DFE-690TXD 32-bit Cardbus Fast Ethernet Adapter Before You Begin You must have at least the following: Windows XP/2000/Me/98se/98

More information

(1) DirectCD. Software Operating Instructions MVC-CD200/CD Sony Corporation

(1) DirectCD. Software Operating Instructions MVC-CD200/CD Sony Corporation 3-067-952-12(1) DirectCD Software Operating Instructions MVC-CD200/CD300 2001 Sony Corporation Notice for users Program Copyright 1999 Adaptec, Inc. All rights reserved./ Documentation 2001 Sony Corporation

More information

Installing Active Directory on a Windows 2012 Server

Installing Active Directory on a Windows 2012 Server Installing Active Directory on a Windows 2012 Server June 18, 2013 Copyright 2013 by World Class CAD, LLC. All Rights Reserved. Setup Security Policies To add a new role such as Active Directory Services

More information

User s Manual CONTENT. Nano NAS Server for USB storages. 1. Product Information Product Specifications System requirements..

User s Manual CONTENT. Nano NAS Server for USB storages. 1. Product Information Product Specifications System requirements.. CONTENT Nano NAS Server for USB storages 1. Product Information...1 2. Product Specifications.2 3. System requirements..3 4. Product Connecting. 4 5. Configuring DN-7023....5 6. Setting... 9 7. Note..

More information

AppWizard Installation/Upgrade Guide (v.4.00)

AppWizard Installation/Upgrade Guide (v.4.00) AppWizard Installation/Upgrade Guide (v.4.00) Last Updated: 15 September 2010 1 Introduction This manual is intended for the installation or upgrade of AppWizard 5.00. Please ensure that all steps are

More information

ខ Network. - Network: KWCamuxviC amyysßitenakñúgepñk Bt_manviTüa. bnþab;bieyig)anbba b;vkásiksaenh eyiggacrkb;rkgrbb½n

ខ Network. - Network: KWCamuxviC amyysßitenakñúgepñk Bt_manviTüa. bnþab;bieyig)anbba b;vkásiksaenh eyiggacrkb;rkgrbb½n ខ Network - Network: KWCamuxviC amyysßitenakñúgepñk Bt_manviTüa. bnþab;bieyig)anbba b;vkásiksaenh eyiggacrkb;rkgrbb½n nwg bnþajducxagerkam³ - echtp ab;bnþajkumbüút½rcaercinegaysáal;kñakñúgekalbmngpøas;bþúr

More information

Microsoft Word - Starting the Mail Merge Wizard

Microsoft Word - Starting the Mail Merge Wizard Microsoft Word - Starting the Mail Merge Wizard Starting the Mail Merge Wizard. 1. Select the Mailings tab. 2. Click the Start Mail Merge button 3. Select Step by step Mil Merge Wizard. 4. Select the type

More information

COINS Ti Call Management System Standard Installation Instructions for Citrix Users

COINS Ti Call Management System Standard Installation Instructions for Citrix Users COINS Ti Call Management System Standard Installation Instructions for Citrix Users COINS recommends that the System Administrator or staff trained in both UNIX and Citrix installation processes perform

More information

LENOVO THINKSTATION P520C, P520, P720, & P920 WINDOWS 7 INSTALLATION

LENOVO THINKSTATION P520C, P520, P720, & P920 WINDOWS 7 INSTALLATION LENOVO THINKSTATION P520C, P520, P720, & P920 WINDOWS 7 INSTALLATION Contents OVERVIEW SECTION 1 BIOS & PRE-INSTALLATION STEPS SECTION 2 WINDOWS 7 DRIVER SLIPSTREAM SETUP SECTION 3 WINDOWS 7 INSTALLATION

More information

Read Naturally SE Update Windows Network Installation Instructions

Read Naturally SE Update Windows Network Installation Instructions Windows Network This document explains how to apply the Read Naturally Software Edition 2.0.3 update to existing installations of SE version 2.0, 2.0.1, or 2.0.2. First update the SE server software, and

More information

Device Manager. Managing Devices CHAPTER

Device Manager. Managing Devices CHAPTER 2 CHAPTER This chapter describes how to perform routine device management tasks using the Administrator Console. It provides information on managing the devices within your Cisco VXC Manager environment.

More information

Set-up Instructions For Mercedes-Benz WIS CD-Rom

Set-up Instructions For Mercedes-Benz WIS CD-Rom Set-up Instructions For Mercedes-Benz WIS CD-Rom IMPORTANT PLEASE READ ALL INSTRUCTIONS THOROUGHLY BEFORE PROCEEDING WITH INSTALLATION Particularly **..** see: STEP 1 Screen resolution must be set to a

More information