Analyzing Evolutionary Trees
|
|
- Agnes Olivia Hardy
- 6 years ago
- Views:
Transcription
1 Analyzing Evolutionary Trees Katherine St. John Lehman College and the Graduate Center City University of New York Katherine St. John City University of New York 1
2 Overview Talk Outline
3 Talk Outline Overview Constructing Trees
4 Talk Outline Overview Constructing Trees Comparing Reconstruction Methods Case Study: Quartet-Based Methods
5 Talk Outline Overview Constructing Trees Comparing Reconstruction Methods Case Study: Quartet-Based Methods Evaluating the Results Comparing, Clustering, and Visualizing Katherine St. John City University of New York 2
6 Talk Outline Overview Constructing Trees Comparing Reconstruction Methods Case Study: Quartet-Based Methods Evaluating the Results Comparing, Clustering, and Visualizing Katherine St. John City University of New York 3
7 Goal: Reconstruct the Evolutionary History (
8 Goal: Reconstruct the Evolutionary History ( The evolutionary process not only determines relationships among taxa, but allows prediction of structural, physiological, and biochemical properties. Katherine St. John City University of New York 4
9 Process for Reconstruction: Input Data Start with information about the taxa. For example: Morphological Characters
10 Process for Reconstruction: Input Data Start with information about the taxa. For example: Morphological Characters Biomolecular Sequences A GTTAGAAGGCGGCCAGCGAC... B CATTTGTCCTAACTTGACGG... C CAAGAGGCCACTGCAGAATC... D CCGACTTCCAACCTCATGCG... E ATGGGGCACGATGGATATCG... F TACAAATACGCGCAAGTTCG... Katherine St. John City University of New York 5
11 Process for Reconstruction
12 Process for Reconstruction Input Data A GTTAGAAGGC... B CATTTGTCCT... C CAAGAGGCCA... D CCGACTTCCA... E ATGGGGCACG... F TACAAATACG...
13 Process for Reconstruction Input Data A GTTAGAAGGC... B CATTTGTCCT... C CAAGAGGCCA... D CCGACTTCCA... E ATGGGGCACG... F TACAAATACG... Reconstruction Algorithms Maximum Parsimony Maximum Likelihood Distance Methods: NJ, Quartet-Based, Fast Convering,.
14 Process for Reconstruction Input Data Reconstruction Algorithms Output Tree A GTTAGAAGGC... B CATTTGTCCT... C CAAGAGGCCA... D CCGACTTCCA... E ATGGGGCACG... F TACAAATACG... Maximum Parsimony Maximum Likelihood Distance Methods: NJ, Quartet-Based, Fast Convering,. Katherine St. John City University of New York 6
15 Applications In addition to finding the evolutionary history of species, phylogeny is also used for:
16 Applications In addition to finding the evolutionary history of species, phylogeny is also used for: drug discovery: used to determine structural and biochemical properties of potential drugs
17 Applications In addition to finding the evolutionary history of species, phylogeny is also used for: drug discovery: used to determine structural and biochemical properties of potential drugs determining origins of HIV infection
18 Applications In addition to finding the evolutionary history of species, phylogeny is also used for: drug discovery: used to determine structural and biochemical properties of potential drugs determining origins of HIV infection origin of other virus and bacteria strains Katherine St. John City University of New York 7
19 Talk Outline Overview Constructing Trees Comparing Reconstruction Methods Case Study: Quartet-Based Methods Evaluating the Results Comparing, Clustering, and Visualizing Katherine St. John City University of New York 8
20 Process for Reconstruction Input Data A GTTAGAAGGC... B CATTTGTCCT... C CAAGAGGCCA... D CCGACTTCCA... E ATGGGGCACG... F TACAAATACG... Reconstruction Algorithms Maximum Parsimony Maximum Likelihood Distance Methods: NJ, Quartet-Based, Fast Convering,. Output Tree Katherine St. John City University of New York 9
21 Algorithms for Reconstruction Most optimization criteria are hard:
22 Algorithms for Reconstruction Most optimization criteria are hard: Maximum Parsimony: (NP-hard: Foulds & Graham 82) find the tree that can explain the observed sequences with a minimal number of substitutions.
23 Algorithms for Reconstruction Most optimization criteria are hard: Maximum Parsimony: (NP-hard: Foulds & Graham 82) find the tree that can explain the observed sequences with a minimal number of substitutions. Maximum Likelihood Estimation: (NP-hard: Roch 06) find the tree with the maximum likelihood: P(data tree).
24 Algorithms for Reconstruction Most optimization criteria are hard: Maximum Parsimony: (NP-hard: Foulds & Graham 82) find the tree that can explain the observed sequences with a minimal number of substitutions. Maximum Likelihood Estimation: (NP-hard: Roch 06) find the tree with the maximum likelihood: P(data tree). For both, the best known algorithms require an exponential number of trees to be checked.
25 Algorithms for Reconstruction Most optimization criteria are hard: Maximum Parsimony: (NP-hard: Foulds & Graham 82) find the tree that can explain the observed sequences with a minimal number of substitutions. Maximum Likelihood Estimation: (NP-hard: Roch 06) find the tree with the maximum likelihood: P(data tree). For both, the best known algorithms require an exponential number of trees to be checked. This is not feasible for more than 20 taxa. Katherine St. John City University of New York 10
26 Approximating Trees Exact answers are often wanted, but hard to find.
27 Approximating Trees Exact answers are often wanted, but hard to find. But approximate is often good enough:
28 Approximating Trees Exact answers are often wanted, but hard to find. But approximate is often good enough: drug design: predicting function via similarity
29 Approximating Trees Exact answers are often wanted, but hard to find. But approximate is often good enough: drug design: predicting function via similarity sequence alignment: guide trees for alignment
30 Approximating Trees Exact answers are often wanted, but hard to find. But approximate is often good enough: drug design: predicting function via similarity sequence alignment: guide trees for alignment use as priors or starting points for expensive searches Katherine St. John City University of New York 11
31 Approximation Algorithms Since calculating the exact answer is hard, algorithms that estimate the answer have been developed.
32 Approximation Algorithms Since calculating the exact answer is hard, algorithms that estimate the answer have been developed. Heuristics for maximum parsimony and maximum likelihood estimation (use clever ways to limit the number of trees checked, while still sampling much of tree-space )
33 Approximation Algorithms Since calculating the exact answer is hard, algorithms that estimate the answer have been developed. Heuristics for maximum parsimony and maximum likelihood estimation (use clever ways to limit the number of trees checked, while still sampling much of tree-space ) Polynomial-time methods, based on the distance between taxa Katherine St. John City University of New York 12
34 Distance-Based Methods These methods calculate the distance between taxa: B D A C F E B D A C F E and then determine the tree using the distance matrix.
35 Distance-Based Methods These methods calculate the distance between taxa: B D A C F E B D A C F E and then determine the tree using the distance matrix. One way to calculate distance is to take differences divided by the length (the normalized Hamming distance). Katherine St. John City University of New York 13
36 Distance-Based Methods Popular distance based methods include
37 Distance-Based Methods Popular distance based methods include Neighbor Joining (Saitou & Nei 87) which repeatedly joins the nearest neighbors to build a tree, and
38 Distance-Based Methods Popular distance based methods include Neighbor Joining (Saitou & Nei 87) which repeatedly joins the nearest neighbors to build a tree, and Quartet-based methods that decide the topology for every 4 taxa and then assemble them to form a tree (Berry et al. 1999, 2000, 2001).
39 Distance-Based Methods Popular distance based methods include Neighbor Joining (Saitou & Nei 87) which repeatedly joins the nearest neighbors to build a tree, and Quartet-based methods that decide the topology for every 4 taxa and then assemble them to form a tree (Berry et al. 1999, 2000, 2001). Many of these methods have good performance empirically, and some can be proven to have nice accuracy properties. Katherine St. John City University of New York 14
40 Testing Methods Empirically How accurate are the methods at reconstructing trees?
41 Testing Methods Empirically How accurate are the methods at reconstructing trees? In biological applications, the true, historical tree is almost never known, which makes assessing the quality of phylogenetic reconstruction methods problematic.
42 Testing Methods Empirically How accurate are the methods at reconstructing trees? In biological applications, the true, historical tree is almost never known, which makes assessing the quality of phylogenetic reconstruction methods problematic. (an exception: Hillis 92 created an evolutionary tree in the laboratory)
43 Testing Methods Empirically How accurate are the methods at reconstructing trees? In biological applications, the true, historical tree is almost never known, which makes assessing the quality of phylogenetic reconstruction methods problematic. (an exception: Hillis 92 created an evolutionary tree in the laboratory) Simulation is used instead to evaluate methods, given a model of evolution. Katherine St. John City University of New York 15
44 Simulation Studies 1. Construct a model tree.
45 Simulation Studies 1. Construct a model tree. 2. Evolve sequences down the tree. A GTTAGAAGGCGGCCA... B CATTTGTCCTAACTT... C CAAGAGGCCACTGCA... D CCGACTTCCAACCTC... E ATGGGGCACGATGGA... F TACAAATACGCGCAA...
46 Simulation Studies 1. Construct a model tree. 2. Evolve sequences down the tree. 3. Reconstruct the tree using method. A GTTAGAAGGCGGCCA... B CATTTGTCCTAACTT... C CAAGAGGCCACTGCA... D CCGACTTCCAACCTC... E ATGGGGCACGATGGA... F TACAAATACGCGCAA...
47 Simulation Studies 1. Construct a model tree. 2. Evolve sequences down the tree. 3. Reconstruct the tree using method. A GTTAGAAGGCGGCCA... B CATTTGTCCTAACTT... C CAAGAGGCCACTGCA... D CCGACTTCCAACCTC... E ATGGGGCACGATGGA... F TACAAATACGCGCAA Evaluate the accuracy of the constructed tree. Katherine St. John City University of New York 16
48 Simulation Studies 1. Construct a model tree. 2. Evolve sequences down the tree. 3. Reconstruct the tree using method. A GTTAGAAGGCGGCCA... B CATTTGTCCTAACTT... C CAAGAGGCCACTGCA... D CCGACTTCCAACCTC... E ATGGGGCACGATGGA... F TACAAATACGCGCAA Evaluate the accuracy of the constructed tree. Katherine St. John City University of New York 17
49 Simulating Data: Choosing Trees Usually chosen from a random distribution on trees: Uniform, or Yule-Harding (birth-death trees)
50 Simulating Data: Choosing Trees Usually chosen from a random distribution on trees: Uniform, or Yule-Harding (birth-death trees) Can view this as two different random processes:
51 Simulating Data: Choosing Trees Usually chosen from a random distribution on trees: Uniform, or Yule-Harding (birth-death trees) Can view this as two different random processes: generate the tree shape, and then
52 Simulating Data: Choosing Trees Usually chosen from a random distribution on trees: Uniform, or Yule-Harding (birth-death trees) Can view this as two different random processes: generate the tree shape, and then assign weights or branch lengths to the shape. Katherine St. John City University of New York 18
53 Simulation Studies 1. Construct a model tree. 2. Evolve sequences down the tree. 3. Reconstruct the tree using method. A GTTAGAAGGCGGCCA... B CATTTGTCCTAACTT... C CAAGAGGCCACTGCA... D CCGACTTCCAACCTC... E ATGGGGCACGATGGA... F TACAAATACGCGCAA Evaluate the accuracy of the constructed tree. Katherine St. John City University of New York 19
54 Simulating Data: Evolving Sequences The Jukes-Cantor (JC) model is the simplest Markov model of biomolecular sequence evolution.
55 Simulating Data: Evolving Sequences The Jukes-Cantor (JC) model is the simplest Markov model of biomolecular sequence evolution. A DNA sequence (a string over {A, C, T, G}) at the root evolves down a rooted binary tree T. AACGT Katherine St. John City University of New York 20
56 Simulating Data: Evolving Sequences The Jukes-Cantor (JC) model is the simplest Markov model of biomolecular sequence evolution. A DNA sequence (a string over {A, C, T, G}) at the root evolves down a rooted binary tree T. AACGT 0 1 AACGA AACGT Katherine St. John City University of New York 21
57 Simulating Data: Evolving Sequences The Jukes-Cantor (JC) model is the simplest Markov model of biomolecular sequence evolution. A DNA sequence (a string over {A, C, T, G}) at the root evolves down a rooted binary tree T. AACGT 0 1 AACGA AACGT ACCCT GACGT AACGA GGCGT Katherine St. John City University of New York 22
58 Simulating Data: Evolving Sequences The Jukes-Cantor (JC) model is the simplest Markov model of biomolecular sequence evolution. A DNA sequence (a string over {A, C, T, G}) at the root evolves down a rooted binary tree T. AACGT 0 1 AACGA AACGT ACCCT GACGT AACGA GGCGT GACGT AACGT GACGT GGCGA Katherine St. John City University of New York 23
59 Simulating Data: Evolving Sequences The Jukes-Cantor (JC) model is the simplest Markov model of biomolecular sequence evolution. A DNA sequence (a string over {A, C, T, G}) at the root evolves down a rooted binary tree T. AACGT 0 1 AACGA AACGT ACCCT GACGT AACGA GGCGT GACGT AACGT GACGT GGCGA Katherine St. John City University of New York 24
60 Simulating Data: Evolving Sequences The Jukes-Cantor (JC) model is the simplest Markov model of biomolecular sequence evolution. A DNA sequence (a string over {A, C, T, G}) at the root evolves down a rooted binary tree T. {ACCCT, GACGT, AACGT, GACGT, GGCGA} Katherine St. John City University of New York 25
61 Simulating Data: Evolving Sequences The Jukes-Cantor (JC) model is the simplest Markov model of biomolecular sequence evolution. A DNA sequence (a string over {A, C, T, G}) at the root evolves down a rooted binary tree T. The assumptions of the model are: 1. the sites (i.e., the positions within the sequences) evolve independently and identically 2. if a site changes state it changes with equal probability to each of the remaining states, and 3. the number of changes of each site on an edge e is a Poisson random variable with expectation λ(e) (this is also called the length of the edge e). Katherine St. John City University of New York 26
62 Simulation Studies 1. Construct a model tree. 2. Evolve sequences down the tree. 3. Reconstruct the tree using method. A GTTAGAAGGCGGCCA... B CATTTGTCCTAACTT... C CAAGAGGCCACTGCA... D CCGACTTCCAACCTC... E ATGGGGCACGATGGA... F TACAAATACGCGCAA Evaluate the accuracy of the constructed tree. Katherine St. John City University of New York 27
63 Simulation Studies 1. Construct a model tree. 2. Evolve sequences down the tree. 3. Reconstruct the tree using method. A GTTAGAAGGCGGCCA... B CATTTGTCCTAACTT... C CAAGAGGCCACTGCA... D CCGACTTCCAACCTC... E ATGGGGCACGATGGA... F TACAAATACGCGCAA Evaluate the accuracy of the constructed tree. Katherine St. John City University of New York 28
64 Evaluating Accuracy To compare reconstructed tree to model tree, the Robinson-Foulds Score is often used: False Positives + False Negatives total edges b a c d e f... b c d a f e
65 Evaluating Accuracy To compare reconstructed tree to model tree, the Robinson-Foulds Score is often used: False Positives + False Negatives total edges b a c d e f... b c d a f e If there are many possible answers, choose the one with the best parsimony score: the sum of the number of site changes acrosss the edges in the tree. Katherine St. John City University of New York 29
66 Talk Outline Overview Constructing Trees Comparing Reconstruction Methods Case Study: Quartet-Based Methods Evaluating the Results Comparing, Clustering, and Visualizing Katherine St. John City University of New York 30
67 Case Study: Quartet Methods A quartet is an unrooted binary tree on four taxa: a b c d {ab cd} a c b d {ac bd} a d b c {ad bc}
68 Case Study: Quartet Methods A quartet is an unrooted binary tree on four taxa: b a d c c a d b d a c b {ab cd} {ac bd} {ad bc} Let Q(T ) = all quartets that agree with T. [Erdős et al. 1997]: T can be reconstructed from Q(T ) in polynomial time. Katherine St. John City University of New York 31
69 Case Study: Quartet Methods Quartet-based methods operate in two phases:
70 Case Study: Quartet Methods Quartet-based methods operate in two phases: Construct quartets on all four taxa sets.
71 Case Study: Quartet Methods Quartet-based methods operate in two phases: Construct quartets on all four taxa sets. Combine these quartets into a tree.
72 Case Study: Quartet Methods Quartet-based methods operate in two phases: Construct quartets on all four taxa sets. Combine these quartets into a tree. Running time: For most optimizations, determining a quartet is fast.
73 Case Study: Quartet Methods Quartet-based methods operate in two phases: Construct quartets on all four taxa sets. Combine these quartets into a tree. Running time: For most optimizations, determining a quartet is fast. There are Θ(n 4 ) quartets, giving Ω(n 4 ) running time.
74 Case Study: Quartet Methods Quartet-based methods operate in two phases: Construct quartets on all four taxa sets. Combine these quartets into a tree. Running time: For most optimizations, determining a quartet is fast. There are Θ(n 4 ) quartets, giving Ω(n 4 ) running time. In practice, the input quality is insufficient to ensure that all quartets are accurately inferred.
75 Case Study: Quartet Methods Quartet-based methods operate in two phases: Construct quartets on all four taxa sets. Combine these quartets into a tree. Running time: For most optimizations, determining a quartet is fast. There are Θ(n 4 ) quartets, giving Ω(n 4 ) running time. In practice, the input quality is insufficient to ensure that all quartets are accurately inferred. Quartet methods have to handle incorrect quartets. Katherine St. John City University of New York 32
76 Popular Quartet Methods Q or Buneman Method [Berry & Gascuel 97, Buneman 71]: Only add edges that agree with all input quartets. Doesn t tolerate errors outputs conservative, but unresolved tree.
77 Popular Quartet Methods Q or Buneman Method [Berry & Gascuel 97, Buneman 71]: Only add edges that agree with all input quartets. Doesn t tolerate errors outputs conservative, but unresolved tree. Quartet Cleaning (QC) [Berry et al. 1999]: Add edges with a small number of errors proportional to q e. Many variants: all handle a small number of errors.
78 Popular Quartet Methods Q or Buneman Method [Berry & Gascuel 97, Buneman 71]: Only add edges that agree with all input quartets. Doesn t tolerate errors outputs conservative, but unresolved tree. Quartet Cleaning (QC) [Berry et al. 1999]: Add edges with a small number of errors proportional to q e. Many variants: all handle a small number of errors. Quartet Puzzling [Strimmer & von Haeseler 1996]: Order taxa randomly, greedily add edges, repeat 1000 times. Output majority tree. Most popular with biologists. Katherine St. John City University of New York 33
79 Standard Method: Neighbor Joining (NJ) [Saitou & Nei 1987]: very popular and fast: O(n 3 ). Based on the distance between nodes, join neighboring leaves, replace them by their parent, calculate distances to this node, and repeat. This process eventually returns a binary (fully resolved) tree. Joining the leaves with the minimal distance does not suffice, so subtract the averaged distances to compensate for long edges. Experimental work shows that NJ trees are reasonably accurate, given a rate of evolution is neither too low nor too high. Katherine St. John City University of New York 34
80 Our Study [St. John, Moret, Warnow, & Vawter: SODA01; J Algorithms 03] A detailed, large-scale experimental study of quartet methods and NJ under the Jukes-Cantor model of evolution:
81 Our Study [St. John, Moret, Warnow, & Vawter: SODA01; J Algorithms 03] A detailed, large-scale experimental study of quartet methods and NJ under the Jukes-Cantor model of evolution: Our results indicate that NJ always outperforms the quartet-based methods we examined, in terms of both accuracy and speed.
82 Our Study [St. John, Moret, Warnow, & Vawter: SODA01; J Algorithms 03] A detailed, large-scale experimental study of quartet methods and NJ under the Jukes-Cantor model of evolution: Our results indicate that NJ always outperforms the quartet-based methods we examined, in terms of both accuracy and speed. Give new theory about convergence rates of quartet-based methods which helps explain our observations. Katherine St. John City University of New York 35
83 Experimental Design: Parameter Space In all, our study used 16,000 datasets and required many months of computation on the two clusters. Taxa: 5, 10, 20, expected evolutionary rates: from to per tree edge. For each, we generated 100 tree shapes, grouped into 10 runs of 10 trials. Sequence lengths: 500, 2,000, 8,000, and 32,000. Katherine St. John City University of New York 36
84 Measuring Accuracy: Quartets and Edges Topological accuracy is a more demanding criterion than quartet accuracy. % tree edges * % quartets (a) seq. length 500 % tree edges ** % quartets (b) seq. length 2000 λ e * (Percent of true tree edges recovered by Quartet Puzzling for 40 taxa and two sequence lengths) Katherine St. John City University of New York 37
85 Sensitivity to Input Quality Methods that estimate quartets and then combine them into a single tree can be greatly affected by the quality of the input quartets. % edges % quartets Q NJ % edges % quartets QCNJ Katherine St. John City University of New York 38
86 Running Times NJ was clearly the fastest method tested.
87 Running Times NJ was clearly the fastest method tested. QCML and QP were by far the slowest of the methods tested, slow enough that running them on more than a fifty taxa appears infeasible at present.
88 Running Times NJ was clearly the fastest method tested. QCML and QP were by far the slowest of the methods tested, slow enough that running them on more than a fifty taxa appears infeasible at present. With default settings, QP takes more than 200 days of computation to analyze ten runs of ten trials each for a single set of parameters on 80 taxa with a sequence length of 500. (30 minutes for NJ). Katherine St. John City University of New York 39
89 Quartet Study Results Quartet quality impacts performance significantly. Maximizing the number of quartets correct doesn t yield better trees.
90 Quartet Study Results Quartet quality impacts performance significantly. Maximizing the number of quartets correct doesn t yield better trees. Clear linear order of accuracy for the methods (except under very low rates of evolution): NJ, QP, QC and Q.
91 Quartet Study Results Quartet quality impacts performance significantly. Maximizing the number of quartets correct doesn t yield better trees. Clear linear order of accuracy for the methods (except under very low rates of evolution): NJ, QP, QC and Q. Study led to the development of new methods that weight quartets and have better accuracy on shorter sequences. Katherine St. John City University of New York 40
92 Talk Outline Overview Constructing Trees Comparing Reconstruction Methods Case Study: Quartet-Based Methods Evaluating the Results Comparing, Clustering, and Visualizing Katherine St. John City University of New York 41
93 Analyzing & Visualizing Sets of Trees Amenta & Klingner, InfoVis 02 Hillis, Heath, & St. John, Sys. Biol. 05 Katherine St. John City University of New York 42
94 Evaluating the Results Often, a search will result in many (often thousands) of trees with the same score.
95 Evaluating the Results Often, a search will result in many (often thousands) of trees with the same score. Input Data A GTTAGAAGGC... B CATTTGTCCT... C CAAGAGGCCA... D CCGACTTCCA... E ATGGGGCACG... F TACAAATACG... Reconstruction Algorithms Maximum Parsimony Maximum Likelihood Distance Methods: NJ, Quartet-Based, Fast Convering,. Output Tree Katherine St. John City University of New York 43
96 Evaluating the Results Often, a search, will result in many (often thousands) of trees with the same score. Input Data A GTTAGAAGGC... B CATTTGTCCT... C CAAGAGGCCA... D CCGACTTCCA... E ATGGGGCACG... F TACAAATACG... Reconstruction Algorithms Maximum Parsimony Maximum Likelihood Output Trees Katherine St. John City University of New York 44
97 Summarizing Trees Input Trees Consensus Method Output Trees Strict Consensus Majority-rule Katherine St. John City University of New York 45
98 Visualizing Sets of Trees Efficiency is important for real-time visualization. Katherine St. John City University of New York 46
99 Strict Consensus Tree Input trees Strict Consensus s 0 s 1 s 2 s 3 s 4 s 0 s 1 s 2 s 3 s 4 s 0 s 1 s 2 s 4 s 3 s 0 s 1 s 2 s 3 s 4 s 1 s 2 s 0 s 3 s 4 s 2 s 3 s 0 s 1 s 4 s 2 s 4 s 0 s 1 s 3 s 1 s 2 s 3 s 0 s 4 s 1 s 2 s 3 s 0 s 4 s 2 s 3 s 4 s 0 s 1 Katherine St. John City University of New York 47
100 Majority-rule Tree Input trees Majority-rule Tree s 0 s 1 s 2 s 3 s 4 s 0 s 1 s 2 s 3 s 4 s 0 s 1 s 2 s 4 s 3 s 0 s 1 s 2 s 3 s 4 Includes splits found in a majority of trees Can be 2/3 majority, etc. Katherine St. John City University of New York 48
101 Running Time Majority-rule Consensus: O((n/w)(nt + lg x)): Margush & McMorris, (x = total number of splits, nt) Implemented in PHYLIP, Felsenstein et al. O(n 2 + nt 2 ): Wareham, O(nt): Amenta, Clarke, & S, WABI 03. Strict Consensus: O(nt): Day, 1985 (assuming w = O(lg n)) Katherine St. John City University of New York 49
102 Our Algorithm Randomized algorithm for majority-rule consensus tree with expected running time O(nt) (n = number of leaves, t = number of trees). Optimal, since reading t trees on n taxa requires Ω(nt) time. Implementation in tree-set visualization software module for Mesquite (W&D Maddison). Katherine St. John City University of New York 50
103 Basic Idea Traverse all input trees in post-order, counting occurrences of splits in a hash table. Build majority-rule tree on splits which appear more than t 2 times. Key issue: Representation of splits Katherine St. John City University of New York 51
104 Distances Between Sets of Trees Katherine St. John City University of New York 52
105 Distances Between Trees Robinson-Foulds distance: # of edges that occur in only one tree. Calculate in O(n) time using Day s Algorithm (1985). Extends naturally to weighted trees. Katherine St. John City University of New York 53
106 Other Natural Metrics Tree-bisection-reconnect (TBR): A C D B E G F A C D B E G F A B A B C D E G F C D G E F TBR is NP-hard. (Allen & Steel 01) Many attempts, but no approximations with provable bounds. Katherine St. John City University of New York 54
107 Other Natural Metrics Subtree-prune-regraft (SPR): A B A B C C G D F D E E G F C D A E B G F NP-hard for rooted trees (Bordewich & Semple 05). 5-approximation for rooted trees (Bonet, Amenta, Mahindru, & S. 06). Katherine St. John City University of New York 55
108 Our Contribution Nicotiana Campanula Scaevola Stokesia Dimorphotheca Senecio Gerbera Gazania Echinops Felicia Tagetes Chromolaena Blennosperma Coreopsis Vernonia Cacosmia Cichorium Achillea Carthamnus Flaveria Piptocarpa Helianthus Tragopogon Chrysanthemum Eupatorium Lactuca Barnadesia Dasyphyllum Nicotiana Campanula Scaevola Stokesia Dimorphotheca Senecio Gazania Gerbera Echinops Felicia Tagetes Chromolaena Blennosperma Coreopsis Vernonia Cacosmia Cichorium Achillea Carthamnus Flaveria Piptocarpa Helianthus Tragopogon Chrysanthemum Eupatorium Lactuca Barnadesia Dasyphyllum Tree-Bisection-Reconnection (TBR): counter-example to past approximation algorithms
109 Our Contribution Nicotiana Campanula Scaevola Stokesia Dimorphotheca Senecio Gerbera Gazania Echinops Felicia Tagetes Chromolaena Blennosperma Coreopsis Vernonia Cacosmia Cichorium Achillea Carthamnus Flaveria Piptocarpa Helianthus Tragopogon Chrysanthemum Eupatorium Lactuca Barnadesia Dasyphyllum Nicotiana Campanula Scaevola Stokesia Dimorphotheca Senecio Gazania Gerbera Echinops Felicia Tagetes Chromolaena Blennosperma Coreopsis Vernonia Cacosmia Cichorium Achillea Carthamnus Flaveria Piptocarpa Helianthus Tragopogon Chrysanthemum Eupatorium Lactuca Barnadesia Dasyphyllum Tree-Bisection-Reconnection (TBR): counter-example to past approximation algorithms Subtree-Prune-Regraft (SPR): First approximation algorithm for rooted SPR Katherine St. John City University of New York 56
110 Approximation Algorithm Outline For each sibling pair (a,b) in the first tree, find in the second and do: Case 1: a b 1 subtree between a & b in T 2 : Cut the subtrees in T 2. N := N + 1 Case 2: a b 2 subtrees between a & b in T 2 : Cut a & b in both. N := N + 2. Case 3: a & b are in separate components for T 2 : Cut a & b in both. N := N + 2. a b Case 4: b is a singleton in T 2 : Cut b in T 1. Note that N doesn t change. a b Case 5: a b The sibling pair occurs in both: Replace by a new node in both. Note that N doesn t change. (Hein et al. version of the algorithm; Rodrigues et al. varies slightly in Cases 1 & 2.) Katherine St. John City University of New York 57
111 Accounting: how good is your estimate? (All based on having a maximum agreement forest for the distance metric.)
112 Accounting: how good is your estimate? (All based on having a maximum agreement forest for the distance metric.) Look at each edge that should be cut (called a link) and see how many extra edges were cut for it. Charge that link the number of edges cut for it.
113 Accounting: how good is your estimate? (All based on having a maximum agreement forest for the distance metric.) Look at each edge that should be cut (called a link) and see how many extra edges were cut for it. Charge that link the number of edges cut for it. Tricky to count! Past attempts for TBR make a subtle mistake that charges non-links. Katherine St. John City University of New York 58
114 Counterexample to Rodrigues et al. 3-Approximation T 1 T a b c d e f g h i j Enlargement of the subtrees between 9 &10: a b c d e f g h i j k l m n o Best Case: Cut the red subtrees; gives TBR distance of 27. Algorithm: Cuts each sibling pair, then subtrees; gives distance of Katherine St. John City University of New York 59
115 5-Approximation With the work of Bordewich & Semple 05, it s now possible to do analysis for rooted SPR.
116 5-Approximation With the work of Bordewich & Semple 05, it s now possible to do analysis for rooted SPR. Slightly modifying the algorithms for TBR, we have a 5-approximation for rooted SPR (very detailed proof).
117 5-Approximation With the work of Bordewich & Semple 05, it s now possible to do analysis for rooted SPR. Slightly modifying the algorithms for TBR, we have a 5-approximation for rooted SPR (very detailed proof). Have an example to show that it can t be better than a 3-approximation, but likely much better in practice.
118 5-Approximation With the work of Bordewich & Semple 05, it s now possible to do analysis for rooted SPR. Slightly modifying the algorithms for TBR, we have a 5-approximation for rooted SPR (very detailed proof). Have an example to show that it can t be better than a 3-approximation, but likely much better in practice. Algorithm runs in linear time. Katherine St. John City University of New York 60
119 Small vs. Large Sets of Trees TreeJuxtaposer compares visually small sets of trees, and Treecomp focuses on comparing, analyzing, and visualizing large sets of phylogenetic trees. Katherine St. John City University of New York 61
120 Comparing Two Trees Will Fisher, UT Katherine St. John City University of New York TreeJuxtaposer, Munzner et al. 62
121 TreeJuxtaposer (Munzner, Guimbretiere, Tasiran, Zhang, & Zhou, SIGGRAPH 2003) Katherine St. John City University of New York 63
122 TreeJuxtaposer Can compare trees of several hundred thousand nodes. Guaranteed visibility: highlighted areas remain visually apparent at all times. Focus+Context navigation technique ( rubber sheet ). Katherine St. John City University of New York 64
123 SequenceJuxtaposer (Slack, Munzner, Hildebrand, & S, 2004) Katherine St. John City University of New York 65
124 SequenceJuxtaposer Accordion drawing guarantees context, visibility, and frame rate. Interactively view a million basepairs. Regular expression searches. Annotation files displayed and navigatable. Katherine St. John City University of New York 66
125 Tree Set Visualization Katherine St. John City University of New York 67
126 Visualizing chains of trees: Color indicates maximum likelihood score Animate feature Applications (Rana dataset from Hillis Lab 500 trees from MrBayes search) Katherine St. John City University of New York 68
127 Summary Constructing Trees: Efficient approximation algorithms for large datasets Comparing Reconstruction Methods: Case Study: Quartet-Based Methods Evaluating the Results: Comparing, Clustering, and Visualizing Katherine St. John City University of New York 69
128 Future Work Efficient heuristics for biological tree differences. Analysis of tree distributions. Dimensionality reduction techniques applied to sequences. Linking TreeJuxtaposer to SequenceJuxtaposer Visualizing & Analyzing Morphological Data Katherine St. John City University of New York 70
129 Acknowledgments National Science Foundation David Hillis Laboratory, U. Texas Wildebeest & Research Clusters at CUNY Mesquite by David and Wayne Maddison treecomp module, many of our students: Left to Right: Back Row: Isaac Boamah (CUNY/UMd), Jeff Klingner (UT/Stanford), Katherine St. John (CUNY), Tamara Munzner (UBC), Silvio Neris (CUNY) Front Row: Denise Edwards (CUNY), Ruchi Kalra (CUNY), Nina Amenta (UT/UCD), Ingrid Montealegre (CUNY), Fred Clarke (CUNY/UCD) Katherine St. John City University of New York 71
DIMACS Tutorial on Phylogenetic Trees and Rapidly Evolving Pathogens. Katherine St. John City University of New York 1
DIMACS Tutorial on Phylogenetic Trees and Rapidly Evolving Pathogens Katherine St. John City University of New York 1 Thanks to the DIMACS Staff Linda Casals Walter Morris Nicole Clark Katherine St. John
More informationApproximating Subtree Distances Between Phylogenies. MARIA LUISA BONET, 1 KATHERINE ST. JOHN, 2,3 RUCHI MAHINDRU, 2,4 and NINA AMENTA 5 ABSTRACT
JOURNAL OF COMPUTATIONAL BIOLOGY Volume 13, Number 8, 2006 Mary Ann Liebert, Inc. Pp. 1419 1434 Approximating Subtree Distances Between Phylogenies AU1 AU2 MARIA LUISA BONET, 1 KATHERINE ST. JOHN, 2,3
More informationCS 581. Tandy Warnow
CS 581 Tandy Warnow This week Maximum parsimony: solving it on small datasets Maximum Likelihood optimization problem Felsenstein s pruning algorithm Bayesian MCMC methods Research opportunities Maximum
More informationSequence length requirements. Tandy Warnow Department of Computer Science The University of Texas at Austin
Sequence length requirements Tandy Warnow Department of Computer Science The University of Texas at Austin Part 1: Absolute Fast Convergence DNA Sequence Evolution AAGGCCT AAGACTT TGGACTT -3 mil yrs -2
More informationPhylogenetics. Introduction to Bioinformatics Dortmund, Lectures: Sven Rahmann. Exercises: Udo Feldkamp, Michael Wurst
Phylogenetics Introduction to Bioinformatics Dortmund, 16.-20.07.2007 Lectures: Sven Rahmann Exercises: Udo Feldkamp, Michael Wurst 1 Phylogenetics phylum = tree phylogenetics: reconstruction of evolutionary
More informationThe Performance of Phylogenetic Methods on Trees of Bounded Diameter
The Performance of Phylogenetic Methods on Trees of Bounded Diameter Luay Nakhleh 1, Usman Roshan 1, Katherine St. John 1 2, Jerry Sun 1, and Tandy Warnow 1 3 1 Department of Computer Sciences, University
More informationMolecular Evolution & Phylogenetics Complexity of the search space, distance matrix methods, maximum parsimony
Molecular Evolution & Phylogenetics Complexity of the search space, distance matrix methods, maximum parsimony Basic Bioinformatics Workshop, ILRI Addis Ababa, 12 December 2017 Learning Objectives understand
More informationAn Experimental Analysis of Robinson-Foulds Distance Matrix Algorithms
An Experimental Analysis of Robinson-Foulds Distance Matrix Algorithms Seung-Jin Sul and Tiffani L. Williams Department of Computer Science Texas A&M University College Station, TX 77843-3 {sulsj,tlw}@cs.tamu.edu
More informationPhylogenetic Trees and Their Analysis
City University of New York (CUNY) CUNY Academic Works Dissertations, Theses, and Capstone Projects Graduate Center 2-2014 Phylogenetic Trees and Their Analysis Eric Ford Graduate Center, City University
More informationParsimony-Based Approaches to Inferring Phylogenetic Trees
Parsimony-Based Approaches to Inferring Phylogenetic Trees BMI/CS 576 www.biostat.wisc.edu/bmi576.html Mark Craven craven@biostat.wisc.edu Fall 0 Phylogenetic tree approaches! three general types! distance:
More informationIntroduction to Triangulated Graphs. Tandy Warnow
Introduction to Triangulated Graphs Tandy Warnow Topics for today Triangulated graphs: theorems and algorithms (Chapters 11.3 and 11.9) Examples of triangulated graphs in phylogeny estimation (Chapters
More informationA RANDOMIZED ALGORITHM FOR COMPARING SETS OF PHYLOGENETIC TREES
A RANDOMIZED ALGORITHM FOR COMPARING SETS OF PHYLOGENETIC TREES SEUNG-JIN SUL AND TIFFANI L. WILLIAMS Department of Computer Science Texas A&M University College Station, TX 77843-3112 USA E-mail: {sulsj,tlw}@cs.tamu.edu
More informationRotation Distance is Fixed-Parameter Tractable
Rotation Distance is Fixed-Parameter Tractable Sean Cleary Katherine St. John September 25, 2018 arxiv:0903.0197v1 [cs.ds] 2 Mar 2009 Abstract Rotation distance between trees measures the number of simple
More informationA Randomized Algorithm for Comparing Sets of Phylogenetic Trees
A Randomized Algorithm for Comparing Sets of Phylogenetic Trees Seung-Jin Sul and Tiffani L. Williams Department of Computer Science Texas A&M University E-mail: {sulsj,tlw}@cs.tamu.edu Technical Report
More informationScaling species tree estimation methods to large datasets using NJMerge
Scaling species tree estimation methods to large datasets using NJMerge Erin Molloy and Tandy Warnow {emolloy2, warnow}@illinois.edu University of Illinois at Urbana Champaign 2018 Phylogenomics Software
More informationDynamic Programming for Phylogenetic Estimation
1 / 45 Dynamic Programming for Phylogenetic Estimation CS598AGB Pranjal Vachaspati University of Illinois at Urbana-Champaign 2 / 45 Coalescent-based Species Tree Estimation Find evolutionary tree for
More informationML phylogenetic inference and GARLI. Derrick Zwickl. University of Arizona (and University of Kansas) Workshop on Molecular Evolution 2015
ML phylogenetic inference and GARLI Derrick Zwickl University of Arizona (and University of Kansas) Workshop on Molecular Evolution 2015 Outline Heuristics and tree searches ML phylogeny inference and
More informationof the Balanced Minimum Evolution Polytope Ruriko Yoshida
Optimality of the Neighbor Joining Algorithm and Faces of the Balanced Minimum Evolution Polytope Ruriko Yoshida Figure 19.1 Genomes 3 ( Garland Science 2007) Origins of Species Tree (or web) of life eukarya
More informationEvolutionary tree reconstruction (Chapter 10)
Evolutionary tree reconstruction (Chapter 10) Early Evolutionary Studies Anatomical features were the dominant criteria used to derive evolutionary relationships between species since Darwin till early
More informationParsimony Least squares Minimum evolution Balanced minimum evolution Maximum likelihood (later in the course)
Tree Searching We ve discussed how we rank trees Parsimony Least squares Minimum evolution alanced minimum evolution Maximum likelihood (later in the course) So we have ways of deciding what a good tree
More informationDesigning parallel algorithms for constructing large phylogenetic trees on Blue Waters
Designing parallel algorithms for constructing large phylogenetic trees on Blue Waters Erin Molloy University of Illinois at Urbana Champaign General Allocation (PI: Tandy Warnow) Exploratory Allocation
More informationOlivier Gascuel Arbres formels et Arbre de la Vie Conférence ENS Cachan, septembre Arbres formels et Arbre de la Vie.
Arbres formels et Arbre de la Vie Olivier Gascuel Centre National de la Recherche Scientifique LIRMM, Montpellier, France www.lirmm.fr/gascuel 10 permanent researchers 2 technical staff 3 postdocs, 10
More informationCodon models. In reality we use codon model Amino acid substitution rates meet nucleotide models Codon(nucleotide triplet)
Phylogeny Codon models Last lecture: poor man s way of calculating dn/ds (Ka/Ks) Tabulate synonymous/non- synonymous substitutions Normalize by the possibilities Transform to genetic distance K JC or K
More informationOn the Optimality of the Neighbor Joining Algorithm
On the Optimality of the Neighbor Joining Algorithm Ruriko Yoshida Dept. of Statistics University of Kentucky Joint work with K. Eickmeyer, P. Huggins, and L. Pachter www.ms.uky.edu/ ruriko Louisville
More informationSPR-BASED TREE RECONCILIATION: NON-BINARY TREES AND MULTIPLE SOLUTIONS
1 SPR-BASED TREE RECONCILIATION: NON-BINARY TREES AND MULTIPLE SOLUTIONS C. THAN and L. NAKHLEH Department of Computer Science Rice University 6100 Main Street, MS 132 Houston, TX 77005, USA Email: {cvthan,nakhleh}@cs.rice.edu
More informationIntroduction to Computational Phylogenetics
Introduction to Computational Phylogenetics Tandy Warnow The University of Texas at Austin No Institute Given This textbook is a draft, and should not be distributed. Much of what is in this textbook appeared
More informationWhat is a phylogenetic tree? Algorithms for Computational Biology. Phylogenetics Summary. Di erent types of phylogenetic trees
What is a phylogenetic tree? Algorithms for Computational Biology Zsuzsanna Lipták speciation events Masters in Molecular and Medical Biotechnology a.a. 25/6, fall term Phylogenetics Summary wolf cat lion
More informationABOUT THE LARGEST SUBTREE COMMON TO SEVERAL PHYLOGENETIC TREES Alain Guénoche 1, Henri Garreta 2 and Laurent Tichit 3
The XIII International Conference Applied Stochastic Models and Data Analysis (ASMDA-2009) June 30-July 3, 2009, Vilnius, LITHUANIA ISBN 978-9955-28-463-5 L. Sakalauskas, C. Skiadas and E. K. Zavadskas
More informationSequence clustering. Introduction. Clustering basics. Hierarchical clustering
Sequence clustering Introduction Data clustering is one of the key tools used in various incarnations of data-mining - trying to make sense of large datasets. It is, thus, natural to ask whether clustering
More informationDistance Methods. "PRINCIPLES OF PHYLOGENETICS" Spring 2006
Integrative Biology 200A University of California, Berkeley "PRINCIPLES OF PHYLOGENETICS" Spring 2006 Distance Methods Due at the end of class: - Distance matrices and trees for two different distance
More informationLecture: Bioinformatics
Lecture: Bioinformatics ENS Sacley, 2018 Some slides graciously provided by Daniel Huson & Celine Scornavacca Phylogenetic Trees - Motivation 2 / 31 2 / 31 Phylogenetic Trees - Motivation Motivation -
More informationComputing the All-Pairs Quartet Distance on a set of Evolutionary Trees
Journal of Bioinformatics and Computational Biology c Imperial College Press Computing the All-Pairs Quartet Distance on a set of Evolutionary Trees M. Stissing, T. Mailund, C. N. S. Pedersen and G. S.
More informationDistances Between Phylogenetic Trees: A Survey
TSINGHUA SCIENCE AND TECHNOLOGY ISSNll1007-0214ll07/11llpp490-499 Volume 18, Number 5, October 2013 Distances Between Phylogenetic Trees: A Survey Feng Shi, Qilong Feng, Jianer Chen, Lusheng Wang, and
More informationCSE 549: Computational Biology
CSE 549: Computational Biology Phylogenomics 1 slides marked with * by Carl Kingsford Tree of Life 2 * H5N1 Influenza Strains Salzberg, Kingsford, et al., 2007 3 * H5N1 Influenza Strains The 2007 outbreak
More informationThe worst case complexity of Maximum Parsimony
he worst case complexity of Maximum Parsimony mir armel Noa Musa-Lempel Dekel sur Michal Ziv-Ukelson Ben-urion University June 2, 20 / 2 What s a phylogeny Phylogenies: raph-like structures whose topology
More informationFast Hashing Algorithms to Summarize Large. Collections of Evolutionary Trees
Texas A&M CS Technical Report 2008-6- June 27, 2008 Fast Hashing Algorithms to Summarize Large Collections of Evolutionary Trees by Seung-Jin Sul and Tiffani L. Williams Department of Computer Science
More informationOutline. Guaranteed Visibility. Accordion Drawing. Guaranteed Visibility Challenges. Guaranteed Visibility Challenges
Outline Scalable Visual Comparison of Biological Trees and Sequences Tamara Munzner University of British Columbia Department of Computer Science ccordion Drawing information visualization technique TreeJuxtaposer
More information1 High-Performance Phylogeny Reconstruction Under Maximum Parsimony. David A. Bader, Bernard M.E. Moret, Tiffani L. Williams and Mi Yan
Contents 1 High-Performance Phylogeny Reconstruction Under Maximum Parsimony 1 David A. Bader, Bernard M.E. Moret, Tiffani L. Williams and Mi Yan 1.1 Introduction 1 1.2 Maximum Parsimony 7 1.3 Exact MP:
More informationAnswer Set Programming or Hypercleaning: Where does the Magic Lie in Solving Maximum Quartet Consistency?
Answer Set Programming or Hypercleaning: Where does the Magic Lie in Solving Maximum Quartet Consistency? Fathiyeh Faghih and Daniel G. Brown David R. Cheriton School of Computer Science, University of
More informationDistance-based Phylogenetic Methods Near a Polytomy
Distance-based Phylogenetic Methods Near a Polytomy Ruth Davidson and Seth Sullivant NCSU UIUC May 21, 2014 2 Phylogenetic trees model the common evolutionary history of a group of species Leaves = extant
More informationRecent Research Results. Evolutionary Trees Distance Methods
Recent Research Results Evolutionary Trees Distance Methods Indo-European Languages After Tandy Warnow What is the purpose? Understand evolutionary history (relationship between species). Uderstand how
More informationA Lookahead Branch-and-Bound Algorithm for the Maximum Quartet Consistency Problem
A Lookahead Branch-and-Bound Algorithm for the Maximum Quartet Consistency Problem Gang Wu Jia-Huai You Guohui Lin January 17, 2005 Abstract A lookahead branch-and-bound algorithm is proposed for solving
More informationTreeCmp 2.0: comparison of trees in polynomial time manual
TreeCmp 2.0: comparison of trees in polynomial time manual 1. Introduction A phylogenetic tree represents historical evolutionary relationship between different species or organisms. There are various
More informationEVOLUTIONARY DISTANCES INFERRING PHYLOGENIES
EVOLUTIONARY DISTANCES INFERRING PHYLOGENIES Luca Bortolussi 1 1 Dipartimento di Matematica ed Informatica Università degli studi di Trieste luca@dmi.units.it Trieste, 28 th November 2007 OUTLINE 1 INFERRING
More informationDistance based tree reconstruction. Hierarchical clustering (UPGMA) Neighbor-Joining (NJ)
Distance based tree reconstruction Hierarchical clustering (UPGMA) Neighbor-Joining (NJ) All organisms have evolved from a common ancestor. Infer the evolutionary tree (tree topology and edge lengths)
More informationIntroduction to Trees
Introduction to Trees Tandy Warnow December 28, 2016 Introduction to Trees Tandy Warnow Clades of a rooted tree Every node v in a leaf-labelled rooted tree defines a subset of the leafset that is below
More informationComputing the Quartet Distance Between Trees of Arbitrary Degrees
January 22, 2006 University of Aarhus Department of Computer Science Computing the Quartet Distance Between Trees of Arbitrary Degrees Chris Christiansen & Martin Randers Thesis supervisor: Christian Nørgaard
More informationSeeing the wood for the trees: Analysing multiple alternative phylogenies
Seeing the wood for the trees: Analysing multiple alternative phylogenies Tom M. W. Nye, Newcastle University tom.nye@ncl.ac.uk Isaac Newton Institute, 17 December 2007 Multiple alternative phylogenies
More informationReconstructing Reticulate Evolution in Species Theory and Practice
Reconstructing Reticulate Evolution in Species Theory and Practice Luay Nakhleh Department of Computer Science Rice University Houston, Texas 77005 nakhleh@cs.rice.edu Tandy Warnow Department of Computer
More informationComparison of commonly used methods for combining multiple phylogenetic data sets
Comparison of commonly used methods for combining multiple phylogenetic data sets Anne Kupczok, Heiko A. Schmidt and Arndt von Haeseler Center for Integrative Bioinformatics Vienna Max F. Perutz Laboratories
More informationChordal Graphs and Evolutionary Trees. Tandy Warnow
Chordal Graphs and Evolutionary Trees Tandy Warnow Possible Indo-European tree (Ringe, Warnow and Taylor 2000) Anatolian Vedic Iranian Greek Italic Celtic Tocharian Armenian Germanic Baltic Slavic Albanian
More informationEfficiently Calculating Evolutionary Tree Measures Using SAT
Efficiently Calculating Evolutionary Tree Measures Using SAT Maria Luisa Bonet 1 and Katherine St. John 2 1 Lenguajes y Sistemas Informáticos, Universidad Politécnica de Cataluña, Spain 2 Math & Computer
More informationHybrid Parallelization of the MrBayes & RAxML Phylogenetics Codes
Hybrid Parallelization of the MrBayes & RAxML Phylogenetics Codes Wayne Pfeiffer (SDSC/UCSD) & Alexandros Stamatakis (TUM) February 25, 2010 What was done? Why is it important? Who cares? Hybrid MPI/OpenMP
More informationGenetics/MBT 541 Spring, 2002 Lecture 1 Joe Felsenstein Department of Genome Sciences Phylogeny methods, part 1 (Parsimony and such)
Genetics/MBT 541 Spring, 2002 Lecture 1 Joe Felsenstein Department of Genome Sciences joe@gs Phylogeny methods, part 1 (Parsimony and such) Methods of reconstructing phylogenies (evolutionary trees) Parsimony
More informationParallel Implementation of a Quartet-Based Algorithm for Phylogenetic Analysis
Parallel Implementation of a Quartet-Based Algorithm for Phylogenetic Analysis B. B. Zhou 1, D. Chu 1, M. Tarawneh 1, P. Wang 1, C. Wang 1, A. Y. Zomaya 1, and R. P. Brent 2 1 School of Information Technologies
More informationLecture 20: Clustering and Evolution
Lecture 20: Clustering and Evolution Study Chapter 10.4 10.8 11/11/2014 Comp 555 Bioalgorithms (Fall 2014) 1 Clique Graphs A clique is a graph where every vertex is connected via an edge to every other
More informationAlgorithms for Bioinformatics
Adapted from slides by Leena Salmena and Veli Mäkinen, which are partly from http: //bix.ucsd.edu/bioalgorithms/slides.php. 582670 Algorithms for Bioinformatics Lecture 6: Distance based clustering and
More informationImprovement of Distance-Based Phylogenetic Methods by a Local Maximum Likelihood Approach Using Triplets
Improvement of Distance-Based Phylogenetic Methods by a Local Maximum Likelihood Approach Using Triplets Vincent Ranwez and Olivier Gascuel Département Informatique Fondamentale et Applications, LIRMM,
More informationPhylogenetics on CUDA (Parallel) Architectures Bradly Alicea
Descent w/modification Descent w/modification Descent w/modification Descent w/modification CPU Descent w/modification Descent w/modification Phylogenetics on CUDA (Parallel) Architectures Bradly Alicea
More informationMain Reference. Marc A. Suchard: Stochastic Models for Horizontal Gene Transfer: Taking a Random Walk through Tree Space Genetics 2005
Stochastic Models for Horizontal Gene Transfer Dajiang Liu Department of Statistics Main Reference Marc A. Suchard: Stochastic Models for Horizontal Gene Transfer: Taing a Random Wal through Tree Space
More informationLecture 20: Clustering and Evolution
Lecture 20: Clustering and Evolution Study Chapter 10.4 10.8 11/12/2013 Comp 465 Fall 2013 1 Clique Graphs A clique is a graph where every vertex is connected via an edge to every other vertex A clique
More informationThe SNPR neighbourhood of tree-child networks
Journal of Graph Algorithms and Applications http://jgaa.info/ vol. 22, no. 2, pp. 29 55 (2018) DOI: 10.7155/jgaa.00472 The SNPR neighbourhood of tree-child networks Jonathan Klawitter Department of Computer
More informationGeneration of distancebased phylogenetic trees
primer for practical phylogenetic data gathering. Uconn EEB3899-007. Spring 2015 Session 12 Generation of distancebased phylogenetic trees Rafael Medina (rafael.medina.bry@gmail.com) Yang Liu (yang.liu@uconn.edu)
More informationLARGE-SCALE ANALYSIS OF PHYLOGENETIC SEARCH BEHAVIOR. A Thesis HYUN JUNG PARK
LARGE-SCALE ANALYSIS OF PHYLOGENETIC SEARCH BEHAVIOR A Thesis by HYUN JUNG PARK Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree
More informationin interleaved format. The same data set in sequential format:
PHYML user's guide Introduction PHYML is a software implementing a new method for building phylogenies from sequences using maximum likelihood. The executables can be downloaded at: http://www.lirmm.fr/~guindon/phyml.html.
More informationA Memetic Algorithm for Phylogenetic Reconstruction with Maximum Parsimony
A Memetic Algorithm for Phylogenetic Reconstruction with Maximum Parsimony Jean-Michel Richer 1 and Adrien Goëffon 2 and Jin-Kao Hao 1 1 University of Angers, LERIA, 2 Bd Lavoisier, 49045 Anger Cedex 01,
More information4/4/16 Comp 555 Spring
4/4/16 Comp 555 Spring 2016 1 A clique is a graph where every vertex is connected via an edge to every other vertex A clique graph is a graph where each connected component is a clique The concept of clustering
More informationFast Parallel Maximum Likelihood-based Protein Phylogeny
Fast Parallel Maximum Likelihood-based Protein Phylogeny C. Blouin 1,2,3, D. Butt 1, G. Hickey 1, A. Rau-Chaplin 1. 1 Faculty of Computer Science, Dalhousie University, Halifax, Canada, B3H 5W1 2 Dept.
More informationComparison of Phylogenetic Trees of Multiple Protein Sequence Alignment Methods
Comparison of Phylogenetic Trees of Multiple Protein Sequence Alignment Methods Khaddouja Boujenfa, Nadia Essoussi, and Mohamed Limam International Science Index, Computer and Information Engineering waset.org/publication/482
More informationA Statistical Test for Clades in Phylogenies
A STATISTICAL TEST FOR CLADES A Statistical Test for Clades in Phylogenies Thurston H. Y. Dang 1, and Elchanan Mossel 2 1 Department of Electrical Engineering and Computer Sciences, University of California,
More informationTopology Inference from Co-Occurrence Observations. Laura Balzano and Rob Nowak with Michael Rabbat and Matthew Roughan
Topology Inference from Co-Occurrence Observations Laura Balzano and Rob Nowak with Michael Rabbat and Matthew Roughan Co-Occurrence observations Co-Occurrence observations Network Inference for Co- Occurrences
More informationMOLECULAR phylogenetic methods reconstruct evolutionary
Calculating the Unrooted Subtree Prune-and-Regraft Distance Chris Whidden and Frederick A. Matsen IV arxiv:.09v [cs.ds] Nov 0 Abstract The subtree prune-and-regraft (SPR) distance metric is a fundamental
More informationReconsidering the Performance of Cooperative Rec-I-DCM3
Reconsidering the Performance of Cooperative Rec-I-DCM3 Tiffani L. Williams Department of Computer Science Texas A&M University College Station, TX 77843 Email: tlw@cs.tamu.edu Marc L. Smith Computer Science
More informationFast Algorithms for Large-Scale Phylogenetic Reconstruction
Fast Algorithms for Large-Scale Phylogenetic Reconstruction by Jakub Truszkowski A thesis presented to the University of Waterloo in fulfillment of the thesis requirement for the degree of Doctor of Philosophy
More informationHeterotachy models in BayesPhylogenies
Heterotachy models in is a general software package for inferring phylogenetic trees using Bayesian Markov Chain Monte Carlo (MCMC) methods. The program allows a range of models of gene sequence evolution,
More informationLab 07: Maximum Likelihood Model Selection and RAxML Using CIPRES
Integrative Biology 200, Spring 2014 Principles of Phylogenetics: Systematics University of California, Berkeley Updated by Traci L. Grzymala Lab 07: Maximum Likelihood Model Selection and RAxML Using
More informationPROTEIN MULTIPLE ALIGNMENT MOTIVATION: BACKGROUND: Marina Sirota
Marina Sirota MOTIVATION: PROTEIN MULTIPLE ALIGNMENT To study evolution on the genetic level across a wide range of organisms, biologists need accurate tools for multiple sequence alignment of protein
More informationAlignment of Trees and Directed Acyclic Graphs
Alignment of Trees and Directed Acyclic Graphs Gabriel Valiente Algorithms, Bioinformatics, Complexity and Formal Methods Research Group Technical University of Catalonia Computational Biology and Bioinformatics
More informationEvolution of Tandemly Repeated Sequences
University of Canterbury Department of Mathematics and Statistics Evolution of Tandemly Repeated Sequences A thesis submitted in partial fulfilment of the requirements of the Degree for Master of Science
More informationApplied Mathematics Letters. Graph triangulations and the compatibility of unrooted phylogenetic trees
Applied Mathematics Letters 24 (2011) 719 723 Contents lists available at ScienceDirect Applied Mathematics Letters journal homepage: www.elsevier.com/locate/aml Graph triangulations and the compatibility
More informationEfficiently Inferring Pairwise Subtree Prune-and-Regraft Adjacencies between Phylogenetic Trees
Efficiently Inferring Pairwise Subtree Prune-and-Regraft Adjacencies between Phylogenetic Trees Downloaded 01/19/18 to 140.107.151.5. Redistribution subject to SIAM license or copyright; see http://www.siam.org/journals/ojsa.php
More informationStudy of a Simple Pruning Strategy with Days Algorithm
Study of a Simple Pruning Strategy with ays Algorithm Thomas G. Kristensen Abstract We wish to calculate all pairwise Robinson Foulds distances in a set of trees. Traditional algorithms for doing this
More informationMultiple Sequence Alignment. Mark Whitsitt - NCSA
Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV
More informationA Memetic Algorithm for Phylogenetic Reconstruction with Maximum Parsimony
A Memetic Algorithm for Phylogenetic Reconstruction with Maximum Parsimony Jean-Michel Richer 1,AdrienGoëffon 2, and Jin-Kao Hao 1 1 University of Angers, LERIA, 2 Bd Lavoisier, 49045 Anger Cedex 01, France
More informationMODERN phylogenetic analyses are rapidly increasing
IEEE CONFERENCE ON BIOINFORMATICS & BIOMEDICINE 1 Accurate Simulation of Large Collections of Phylogenetic Trees Suzanne J. Matthews, Member, IEEE, ACM Abstract Phylogenetic analyses are growing at a rapid
More informationThe History Bound and ILP
The History Bound and ILP Julia Matsieva and Dan Gusfield UC Davis March 15, 2017 Bad News for Tree Huggers More Bad News Far more convincingly even than the (also highly convincing) fossil evidence, the
More informationSystematics - Bio 615
The 10 Willis (The commandments as given by Willi Hennig after coming down from the Mountain) 1. Thou shalt not paraphyle. 2. Thou shalt not weight. 3. Thou shalt not publish unresolved nodes. 4. Thou
More informationMarkovian Models of Genetic Inheritance
Markovian Models of Genetic Inheritance Elchanan Mossel, U.C. Berkeley mossel@stat.berkeley.edu, http://www.cs.berkeley.edu/~mossel/ 6/18/12 1 General plan Define a number of Markovian Inheritance Models
More informationhuman chimp mouse rat
Michael rudno These notes are based on earlier notes by Tomas abak Phylogenetic Trees Phylogenetic Trees demonstrate the amoun of evolution, and order of divergence for several genomes. Phylogenetic trees
More informationConsistent and Efficient Reconstruction of Latent Tree Models
Stochastic Systems Group Consistent and Efficient Reconstruction of Latent Tree Models Myung Jin Choi Joint work with Vincent Tan, Anima Anandkumar, and Alan S. Willsky Laboratory for Information and Decision
More informationTerminology. A phylogeny is the evolutionary history of an organism
Phylogeny Terminology A phylogeny is the evolutionary history of an organism A taxon (plural: taxa) is a group of (one or more) organisms, which a taxonomist adjudges to be a unit. A definition? from Wikipedia
More informationCISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment
CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features
More informationOutline. Phylogenetic/Evolutionary Tree. Common Dataset Size Today. Paper Comparison: Multiple Trees
Outline TreeJuxtaposer Scalable Visual Comparison of Biological Trees and Sequences tree comparison Accordion Drawing information visualization technique SequenceJuxtaposer Tamara Munzner University of
More informationA New Algorithm for the Reconstruction of Near-Perfect Binary Phylogenetic Trees
A New Algorithm for the Reconstruction of Near-Perfect Binary Phylogenetic Trees Kedar Dhamdhere, Srinath Sridhar, Guy E. Blelloch, Eran Halperin R. Ravi and Russell Schwartz March 17, 2005 CMU-CS-05-119
More informationNotes 4 : Approximating Maximum Parsimony
Notes 4 : Approximating Maximum Parsimony MATH 833 - Fall 2012 Lecturer: Sebastien Roch References: [SS03, Chapters 2, 5], [DPV06, Chapters 5, 9] 1 Coping with NP-completeness Local search heuristics.
More informationPhylogenetic Trees Lecture 12. Section 7.4, in Durbin et al., 6.5 in Setubal et al. Shlomo Moran, Ilan Gronau
Phylogenetic Trees Lecture 12 Section 7.4, in Durbin et al., 6.5 in Setubal et al. Shlomo Moran, Ilan Gronau. Maximum Parsimony. Last week we presented Fitch algorithm for (unweighted) Maximum Parsimony:
More informationHigh-Performance Algorithm Engineering for Computational Phylogenetics
High-Performance Algorithm Engineering for Computational Phylogenetics Bernard M.E. Moret moret@cs.unm.edu Department of Computer Science University of New Mexico Albuquerque, NM 87131 High-Performance
More informationCooperative Rec-I-DCM3: A Population-Based Approach for Reconstructing Phylogenies
Cooperative Rec-I-DCM3: A Population-Based Approach for Reconstructing Phylogenies Tiffani L. Williams Department of Computer Science Texas A&M University tlw@cs.tamu.edu Marc L. Smith Department of Computer
More informationAlgorithms for Computing Cluster Dissimilarity between Rooted Phylogenetic
Send Orders for Reprints to reprints@benthamscience.ae 8 The Open Cybernetics & Systemics Journal, 05, 9, 8-3 Open Access Algorithms for Computing Cluster Dissimilarity between Rooted Phylogenetic Trees
More informationON HEURISTIC METHODS IN NEXT-GENERATION SEQUENCING DATA ANALYSIS
ON HEURISTIC METHODS IN NEXT-GENERATION SEQUENCING DATA ANALYSIS Ivan Vogel Doctoral Degree Programme (1), FIT BUT E-mail: xvogel01@stud.fit.vutbr.cz Supervised by: Jaroslav Zendulka E-mail: zendulka@fit.vutbr.cz
More information