SureChem and ChEMBL. ACS CINF webinar. John P. Overington & Nicko Goncharoff
|
|
- Gervais Flynn
- 5 years ago
- Views:
Transcription
1 SureChem and ChEMBL ACS CINF webinar John P. Overington & Nicko Goncharoff 8 th April 2014
2 Assay/Target ChEMBL Data for Drug Discovery 1. Scientific facts 3. Insight, tools and resources for translational drug discovery >Thrombin MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLE RECVEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGT NYRGHVNITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYT TDPTVRRQECSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVT THGLPCLAWASAQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGY CDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLF EKKSLEDKTERELLESYIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDR WVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWR ENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTA NVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE K i = 4.5nM Compound Bioactivity data APTT = 11 min. 2. Organization, integration, curation and standardization of pharmacology data
3 Overview of EMBL-EBI Chemistry Resources ChEBI ChEMBL SureChEMBL PDBe Atlas Structures, metadata for metabolites. Chemical Ontology Bioactivity data from literature and depositions Ligand structures from patent literature Ligand structures from structurally defined protein complexes Ligand induced transcript response UniChem InChI-based resolver (full + relaxed lenses ) ~70M
4 ChEMBL The world s largest primary public database of medicinal chemistry data ~1.4 million compounds, ~9,000 targets, ~12 million bioactivities Truly Open Data - CC-BY- SA license Many download/access formats Semantic Web RDF download, SPARQL endpoint at ChEMBL Applicances mychembl linux VM ChEMpi raspberry pi
5 SureChEMBL EMBL-EBI acquired the SureChem product from Digital Science State-of-the-art chemistry patent product 15 million chemical structures Automatically extracted chemical structures from fulltext patent Research community wants open access to patent data Patent literature 2-3 years ahead of published literature Better competitive position Plan to provide ongoing free, Open resource to entire community
6 SureChEMBL Overview Patent Offices WO SureChem System Amazon Web Services Molfiles in patent Chemistry Database US Applications & granted EP Applications & Granted Processed patents Entity Recognition Image to Structure (one method) Name to Structure (five methods) Database JP Abstracts API Application Server Patent PDFs Users
7 Immediate Priorities Migrate working pipeline across to EMBL-EBI servers Establish new account system Migrate current user accounts Offer GUI access at SureChem Pro equivalent level Turn off API access and refactor new API in OpenPHACTS framework Partners in OpenPHACTS will get early test access and input into development pipeline Build RDF version of SureChEMBL
8 Future Plans Dependent on funding and interest! Add sequence searching Add disease term, animal disease model, etc. indexing KNIME/Pipeline Pilot nodes Add links to/from Europe PMC Extend image extraction retrospectively from 2006 spot pricing compute from AWS Provide weekly/monthly feed of patent structures to PubChem and ChemSpider Add chemical structure tagging & search to full text content of Europe PMC Develop UniChem VM for in-house private patent alerting using feed of SureChEMBL data
9 Keyword search The search interface Patent number search Filter by authority help Structure sketch Types of chemistry search Filter by date help Paste SMILES, MOL, name Filter by document section
10 Keyword-based search Example Searches roche OR novartis C07D sterili?e kinase* Pfizer C07D kinase inhibitor pn: WO A1 pa:(bayer OR astra OR Genentech OR merck) AND desc:(chemotherap* AND (Phosphoinositide kinases~3 OR Pi3K))
11 Fielded keyword search Keyword search Filter by document section Logical operators
12 Patent number search
13 Patent number search
14 Chemistry-based search Types of search Structure sketch Filter by MW range Paste SMILES, MOL, name Filter by document section
15 Example searches Retrieve all antimalarial small molecule US patents ic:c07d AND ic:a61p AND pnctry:us Retrieve a specific patent pn:wo a1 Similarity search (sildenafil nearest neighbours) Paste CCCc1nn(C)c2C(=O)NC(=Nc12)c3cc(ccc3OCC)S(=O)(=O)N4C CN(C)CC4
16 Example search
17 Review the hits
18 Review the hits
19 Select a subset of hits
20 Export hits (Pro user) Property range filters Count filters
21 Select a subset of hits
22 Review patent documents
23 Retrieve patent families
24 Review patent documents
25 Retrieve chemistry (Pro user) Property range filters Count filters
26 Summary Searching capabilities Free text keywords and Lucene fields Patent IDs & bibliographic information Patent authority & date Structure Retrieving capabilities Retrieve chemistry (with additional filters) Retrieve patent family information Retrieve annotated full patent text
27 Any questions?
Open PHACTS. An Introduction and Explanation March Acknowledgements: Contains contributions from across the Open PHACTS partners.
Open PHACTS An Introduction and Explanation March 2012 Acknowledgements: Contains contributions from across the Open PHACTS partners. Public Domain Drug Discovery Data: Pharma are accessing, processing,
More informationOpen PHACTS. Deliverable 5.3.4
Deliverable 5.3.4 First release of Polypharmacology browser, Pharmatrek, to community The Poly-pharmacology Browsers Prepared by DTU, PSMAR Approved by DTU, PSMAR, AZ, Janssen, UNIVIE September 2013 Version
More informationRDF Workshop. Building an RDF representation of the the ChEMBL Database. Mark Davies. ChEMBL Group, Technical Lead 30/04/2014
RDF Workshop Building an RDF representation of the the ChEMBL Database Mark Davies ChEMBL Group, Technical Lead 30/04/2014 Overview Brief introduction to ChEMBL database Approaches to mapping relational
More informationCustomisable Curation Workflows in Argo
Customisable Curation Workflows in Argo Rafal Rak*, Riza Batista-Navarro, Andrew Rowley, Jacob Carter and Sophia Ananiadou National Centre for Text Mining, University of Manchester, UK *Corresponding author:
More informationPowering Knowledge Discovery. Insights from big data with Linguamatics I2E
Powering Knowledge Discovery Insights from big data with Linguamatics I2E Gain actionable insights from unstructured data The world now generates an overwhelming amount of data, most of it written in natural
More informationPfizerpedia Patents The Who, what when and why of patents. David Walsh, Andrew Berridge, RDMi, Pfizer, Sandwich
Pfizerpedia Patents The Who, what when and why of patents David Walsh, Andrew Berridge, RDMi, Pfizer, Sandwich We are Pfizer - We like Patents! Lipitor patent The best selling US prescription medicine
More informationGábor Imre MADFAST SIMILARITY SEARCH
Gábor Imre MADFAST SIMILARITY SEARCH How fast is MadFast? Some numbers measured on an Amazon EC2 c3.8xlarge/r3.8xlarge machine How fast is MadFast? Some numbers measured on an Amazon EC2 c3.8xlarge/r3.8xlarge
More informationDeliverable D4.3 Release of pilot version of data warehouse
Deliverable D4.3 Release of pilot version of data warehouse Date: 10.05.17 HORIZON 2020 - INFRADEV Implementation and operation of cross-cutting services and solutions for clusters of ESFRI Grant Agreement
More informationTEXT MINING: THE NEXT DATA FRONTIER
TEXT MINING: THE NEXT DATA FRONTIER An Infrastructural Approach Dr. Petr Knoth CORE (core.ac.uk) Knowledge Media institute, The Open University United Kingdom 2 OpenMinTeD Establish an open and sustainable
More informationIntegrating text and literature sources with traditional chemoinformatics tools
Integrating text and literature sources with traditional chemoinformatics tools David J. Wild, djwild@indiana.edu Assistant Professor Informatics Bloomington Indiana ACS Chicago, March 2007 online materials
More informationUnstructured Text in Big Data The Elephant in the Room
Unstructured Text in Big Data The Elephant in the Room David Milward ICIC, October 2013 Click Unstructured to to edit edit Master Master Big title Data style title style Big Data Volume, Variety, Velocity
More informationOne Search Many Answers
One Search Many Answers Bringing together results from multiple databases through the DiscoveryGate Platform Carmen Nitsche, VP Content Fall 2009 ACS Meeting Washington, D.C. Information Driven R&D Is
More informationKNIME Enalos+ Molecular Descriptor nodes
KNIME Enalos+ Molecular Descriptor nodes A Brief Tutorial Novamechanics Ltd Contact: info@novamechanics.com Version 1, June 2017 Table of Contents Introduction... 1 Step 1-Workbench overview... 1 Step
More informationMaximizing the Value of STM Content through Semantic Enrichment. Frank Stumpf December 1, 2009
Maximizing the Value of STM Content through Semantic Enrichment Frank Stumpf December 1, 2009 What is Semantics and Semantic Processing? Content Knowledge Framework Technology Framework Search Text Images
More informationDeliverable D5.5. D5.5 VRE-integrated PDBe Search and Query API. World-wide E-infrastructure for structural biology. Grant agreement no.
Deliverable D5.5 Project Title: World-wide E-infrastructure for structural biology Project Acronym: West-Life Grant agreement no.: 675858 Deliverable title: D5.5 VRE-integrated PDBe Search and Query API
More informationLife Sciences Oracle Based Solutions. June 2004
Life Sciences Oracle Based Solutions June 2004 Overview of Accelrys Leading supplier of computation tools to the life science and informatics research community: Bioinformatics Cheminformatics Modeling/Simulation
More informationOpen PHACTS Explorer: Pharmacology by Enzyme Family
Open PHACTS Explorer: Pharmacology by Enzyme Family This document is a tutorial for using Open PHACTS Explorer (explorer.openphacts.org) to obtain pharmacological information for families of enzymes classified
More informationVisual Concept Detection and Linked Open Data at the TIB AV- Portal. Felix Saurbier, Matthias Springstein Hamburg, November 6 SWIB 2017
Visual Concept Detection and Linked Open Data at the TIB AV- Portal Felix Saurbier, Matthias Springstein Hamburg, November 6 SWIB 2017 Agenda 1. TIB and TIB AV-Portal 2. Automated Video Analysis 3. Visual
More informationRDF friendly Chemical Taxonomies for Semantic Web (Using ORACLE/MySQL
RDF friendly Chemical Taxonomies for Semantic Web (Using ORACLE/MySQL MySQL) Downloads T.N.Bhat Bhat*, J. Barkley NIST, Gaithersburg USA bhat@nist.gov Query 3-D data Query 2-D data Prasanna MD, Vondrasek
More informationSELF-SERVICE SEMANTIC DATA FEDERATION
SELF-SERVICE SEMANTIC DATA FEDERATION WE LL MAKE YOU A DATA SCIENTIST Contact: IPSNP Computing Inc. Chris Baker, CEO Chris.Baker@ipsnp.com (506) 721 8241 BIG VISION: SELF-SERVICE DATA FEDERATION Biomedical
More informationQuick Reference Guide
Quick Reference Guide Contents 1. The Query Page 3 2. Constructing Queries: Reactions 4 Substances 5 Medical Chemistry 7 Literature 8 Properties 9 Natural Products 10 3. Results: Filters 11 Analysis View
More informationKNIME Enalos+ Modelling nodes
KNIME Enalos+ Modelling nodes A Brief Tutorial Novamechanics Ltd Contact: info@novamechanics.com Version 1, June 2017 Table of Contents Introduction... 1 Step 1-Workbench overview... 1 Step 2-Building
More informationTransitioning to Symyx
Whitepaper Transitioning to Symyx Notebook by Accelrys from Third-Party Electronic Lab Notebooks Ordinarily in a market with strong growth, vendors do not focus on competitive displacement of competitor
More informationFacilitating Semantic Alignment of EBI Resources
Facilitating Semantic Alignment of EBI Resources 17 th March, 2017 Tony Burdett Technical Co-ordinator Samples, Phenotypes and Ontologies Team www.ebi.ac.uk What is EMBL-EBI? Europe s home for biological
More informationToxPredict Beta Testing Report Template
ToxPredict Beta Testing Report Template Grant Agreement Acronym Name Coordinator Health-F5-2008-200787 OpenTox An Open Source Predictive Toxicology Framework Douglas Connect Contract No. Document Type:
More informationWebinar Annotate data in the EUDAT CDI
Webinar Annotate data in the EUDAT CDI Yann Le Franc - e-science Data Factory, Paris, France March 16, 2017 This work is licensed under the Creative Commons CC-BY 4.0 licence. Attribution: Y. Le Franc
More informationThe Expansive Reach of ChemSpider as a Resource for the Chemistry Community. Antony Williams University of Oregon, April 24 th 2013
The Expansive Reach of ChemSpider as a Resource for the Chemistry Community Antony Williams University of Oregon, April 24 th 2013 The World of Online Chemistry Property databases Compound aggregators
More informationEMBL-EBI Patent Services
EMBL-EBI Patent Services 5 th Annual Forum for SMEs October 6-7 th 2011 Jennifer McDowall EBI is an Outstation of the European Molecular Biology Laboratory. Patent resources at EBI 2 http://www.ebi.ac.uk/patentdata/
More informationHow to Work with a Reference Answer Set
How to Work with a Reference Answer Set Easily identify and isolate references of interest Quickly retrieve relevant information from the world s largest, publicly available reference database for chemistry
More informationNew generation of patent sequence databases Information Sources in Biotechnology Japan
New generation of patent sequence databases Information Sources in Biotechnology Japan EBI is an Outstation of the European Molecular Biology Laboratory. Patent-related resources Patents Patent Resources
More informationTrilateral Search Guidebook in Biotechnology. [Ver.1 Publication ]
Trilateral Project DR2 Biotechnology Trilateral Search Guidebook in Biotechnology [Ver.1 Publication ] Part I 26 April 2007 United States Patent and trademark Office European Patent Office Japan Patent
More informationSemantic Knowledge Discovery OntoChem IT Solutions
Semantic Knowledge Discovery OntoChem IT Solutions OntoChem IT Solutions GmbH Blücherstr. 24 06120 Halle (Saale) Germany Tel. +49 345 4780472 Fax: +49 345 4780471 mail: info(at)ontochem.com Get the Gold!
More informationStructural Bioinformatics
Structural Bioinformatics Elucidation of the 3D structures of biomolecules. Analysis and comparison of biomolecular structures. Prediction of biomolecular recognition. Handles three-dimensional (3-D) structures.
More informationBrowsing Large Scale Cheminformatics Data with Dimension Reduction
Browsing Large Scale Cheminformatics Data with Dimension Reduction Jong Youl Choi, Seung-Hee Bae, Judy Qiu School of Informatics and Computing Pervasive Technology Institute Indiana University Bloomington
More informationReaxysTutorial. Dr. QF Carlos F. Lagos
ReaxysTutorial Dr. QF Carlos F. Lagos Agenda 1) Reaxys Basics Main Settings Query Menu: Reaction, Substances and Properties, Authors and citations Generate a structure t from a name Commercial Availability
More informationLuke S. Fisher, Ph.D. Manager, Client Services US Modeling and Simulation Support. July 24 th, 2008
Workflow Customization with the DS Developer Client Luke S. Fisher, Ph.D. Manager, Client Services US Modeling and Simulation Support July 24 th, 2008 New Science and Customized Workflows for Drug Discovery
More informationPSF Project MMS Virtual LAB
PSF Project 2016-2017 MMS Virtual LAB Molecular Modeling Section (MMS) Dip. Scienze del Farmaco Target SMILE Nc1nc(N)c2nc(c(N)nc2n1)-c1cccc(Cl)c1 Aim of the Project 1. Characterize the reference 6-(3-chlorophenyl)pteridine-2,4,7-triamine
More informationSome useful resources. Data-mining
Some useful resources Data-mining Data Mining? Yeah, I could use a nap What We ll Discuss Why search Who should do it Sources National Library of Medicine Includes the NLM Gateway, PubMed, ClinicalTrials.gov,
More informationBuilding innovative drug discovery alliances. Migrating to ChemAxon
Building innovative drug discovery alliances Migrating to ChemAxon Evotec AG, Migrating to ChemAxon, May 2011 Agenda Evotec Why migrate? Searching for Library Enumeration Replacement Migrating a small
More informationSciFinder Training Materials July 2017
SciFinder Training Materials July 07 Table of contents: Contents Slide No. SciFinder Overview How to Create a Reference Answer Set Search by Research Topic 6 How to Work with a Reference Answer Set 8 Search
More informationBuilding innovative drug discovery alliances. Knime Desktop tools for chemists
Building innovative drug discovery alliances Knime Desktop tools for chemists Evotec AG, Knime desktop tools for chemists, May 2011 Agenda Knime Getting project data from Excel spreadsheets Getting project
More informationGuide to Database Curation and New Structure Deposition January 2010
and New Structure Deposition January 2010 Copyright RSC Worldwide Ltd Table of Contents 1. Introduction Overview of content of ChemSpider What is Data Curation 2. How to Get Started Site Registration Logging
More informationSciFinder Training Materials
SciFinder Training Materials # Contents Page How to Create a Substance Answer Set - Search by chemical structure, molecular formula, and substance identifier How to Work with a Substance Answer Set - Analyze
More informationSemantic MediaWiki (SMW) for Scientific Literature Management
Semantic MediaWiki (SMW) for Scientific Literature Management Bahar Sateli, René Witte Semantic Software Lab Department of Computer Science and Software Engineering Concordia University, Montréal SMWCon
More informationChemotion funded by. Göttingen eresearch Toolbox Series - Electronic Note Keeping. Nicole Jung.
Göttingen eresearch Toolbox Series - Electronic Note Keeping Nicole Jung INSTITUTE OF ORGANIC CHEMISTRY - Stefan Bräse Group Karlsruhe Chemotion funded by KIT University of the State of Baden-Wuerttemberg
More informationData Immersion : Providing Integrated Data to Infinity Scientists. Kevin Gilpin Principal Engineer Infinity Pharmaceuticals October 19, 2004
Data Immersion : Providing Integrated Data to Infinity Scientists Kevin Gilpin Principal Engineer Infinity Pharmaceuticals October 19, 2004 Informatics at Infinity Understand the nature of the science
More informationMarkush Structure Usability in Patent and Combinatorial Chemistry: New Approaches and Software Tools. Wei Deng (David)
Markush Structure Usability in Patent and Combinatorial Chemistry: New Approaches and Software Tools Wei Deng (David) Chemical Space in Patents Exemplified structures Chemical space: 10 0-10 3 Indexed
More informationEBI services. Jennifer McDowall EMBL-EBI
EBI services Jennifer McDowall EMBL-EBI The SLING project is funded by the European Commission within Research Infrastructures of the FP7 Capacities Specific Programme, grant agreement number 226073 (Integrating
More informationNOW ON. Mike Takats Thomson Reuters April 30, 2013
NOW ON Mike Takats Thomson Reuters April 30, 2013 Thomson Reuters, ISI and the Web of Knowledge OVER 50 YEARS OF EXPERIENCE IN CITATION INDEXING, ANALYSIS AND METRICS In 1955, Dr. Eugene Garfield revolutionized
More informationEnabling Open Science: Data Discoverability, Access and Use. Jo McEntyre Head of Literature Services
Enabling Open Science: Data Discoverability, Access and Use Jo McEntyre Head of Literature Services www.ebi.ac.uk About EMBL-EBI Part of the European Molecular Biology Laboratory International, non-profit
More informationThe ELIXIR of Linked Data
The ELIXIR of Linked Data Professor Carole Goble (UK node) Barend Mons (NL node), Helen Parkinson (EMBL-EBI node) The Interoperability Services Backbone Team European Life Sciences Infrastructure for Biological
More informationOverview. IBEX - access and exploit SAR data from patents and journals
Better Compounds. Faster IBEX - access and exploit SAR data from patents and journals Péter Várkonyi, Christian Hoppe, Sorel Muresan AZ Global Compound Sciences Computational Chemistry Overview GVKBIO
More informationHow to Work with a Substance Answer Set
How to Work with a Substance Answer Set Easily identify and isolate substances of interest Quickly retrieve relevant information from the world s largest, publicly available substance database. This guide
More informationUpdate: MIRIAM Registry and SBO
Update: MIRIAM Registry and SBO Nick Juty, EMBL-EBI 3rd Sept, 2011 Overview MIRIAM Registry MIRIAM Guidelines.. MIRIAM Registry content URIs (URN form), example Summary/current developments SBO Purpose
More informationExploring the Generation and Integration of Publishable Scientific Facts Using the Concept of Nano-publications
Exploring the Generation and Integration of Publishable Scientific Facts Using the Concept of Nano-publications Amanda Clare 1,3, Samuel Croset 2,3 (croset@ebi.ac.uk), Christoph Grabmueller 2,3, Senay
More informationNCI Thesaurus, managing towards an ontology
NCI Thesaurus, managing towards an ontology CENDI/NKOS Workshop October 22, 2009 Gilberto Fragoso Outline Background on EVS The NCI Thesaurus BiomedGT Editing Plug-in for Protege Semantic Media Wiki supports
More informationNew STN and BizInt Smart Charts
BizInt Smart Charts 2015 1 New STN and BizInt Smart Charts EPO Patent Information Conference November 11, 2015 John Willmore, VP Product Development BizInt Smart Charts 2015 2 Agenda Creating reports from
More informationTriple store databases and their role in high throughput, automated extensible data analysis
Triple store databases and their role in high throughput, automated extensible data analysis San Diego CINF Talk: Workflow! Introduction to the Combechem Project! Smart Dark Labs! Semantics & Databases!
More informationThe CALBC RDF Triple store: retrieval over large literature content
The CALBC RDF Triple store: retrieval over large literature content Samuel Croset, Christoph Grabmüller, Chen Li, Silverstras Kavaliauskas, Dietrich Rebholz-Schuhmann croset@ebi.ac.uk 10 th December 2010,
More informationUsing the List management features can be a useful way of collecting a set of results ready for export.
Exporting Data Exporting Data Specifying details Monitoring progress Relational data export Exporting to new local DB Data from database tables can be exported from IJC to various common file formats.
More informationNOTSL Fall Meeting, October 30, 2015 Cuyahoga County Public Library Parma, OH by
NOTSL Fall Meeting, October 30, 2015 Cuyahoga County Public Library Parma, OH by Roman S. Panchyshyn Catalog Librarian, Assistant Professor Kent State University Libraries This presentation will address
More informationWelcome - webinar instructions
Welcome - webinar instructions GoToTraining works best in Chrome or IE avoid Firefox due to audio issues with Macs To access the full features of GoToTraining, use the desktop version by clicking switch
More informationGraph Modeling and Analysis in Oracle
Graph Modeling and Analysis in Oracle Susie Stephens Principal Product Manager, Life Sciences Oracle Corporation BioPathways, July 30, 2004 Access Distributed Data UltraSearch External Sites Distributed
More informationBig Linked Data ETL Benchmark on Cloud Commodity Hardware
Big Linked Data ETL Benchmark on Cloud Commodity Hardware iminds Ghent University Dieter De Witte, Laurens De Vocht, Ruben Verborgh, Erik Mannens, Rik Van de Walle Ontoforce Kenny Knecht, Filip Pattyn,
More informationBioqueries: A Social Community Sharing Experiences while Querying Biological Linked Data (
Bioqueries: A Social Community Sharing Experiences while Querying Biological Linked Data (http://bioqueries.uma.es) María Jesús García-Godoy, Ismael Navas-Delgado, José Francisco Aldana Montes Computing
More informationData management and integration
Development of Predictive Toxicology Applications An OpenTox Workshop 19 Sep 2010, Rhodes, Greece Data management and integration presented by Nina Jeliazkova (Ideaconsult Ltd., Bulgaria) Outline Ontology
More informationirods for Data Management and Archiving UGM 2018 Masilamani Subramanyam
irods for Data Management and Archiving UGM 2018 Masilamani Subramanyam Agenda Introduction Challenges Data Transfer Solution irods use in Data Transfer Solution irods Proof-of-Concept Q&A Introduction
More informationGeosemantically-enhanced PubMed Queries Using the Geonames Ontology and Web Services
Geosemantically-enhanced PubMed Queries Using the Geonames Ontology and Web Services Maged N. Kamel Boulos, PhD, MSc, MBBCh Plymouth University, UK mnkboulos@ieee.org Agenda About PubMed and MeSH The Problem
More informationDevelopment of Text Mining Tools for Information Retrieval from Patents
Development of Text Mining Tools for Information Retrieval from Patents Tiago Alves 1,2(B),Rúben Rodrigues 1, Hugo Costa 2, and Miguel Rocha 1 1 Centre Biological Engineering, University of Minho, 4710-057
More informationQuick Guide 1: Legal Analytics
Quick Guide 1: Legal Analytics Court Analytics 1. Go to Courts & Judges from the menu bar. 2. Enter the name of the court in the Search for Courts keyword search box on the left, and hit enter. 3. This
More informationenanomapper database, search tools and templates Nina Jeliazkova, Nikolay Kochev IdeaConsult Ltd. Sofia, Bulgaria
enanomapper database, search tools and templates Nina Jeliazkova, Nikolay Kochev IdeaConsult Ltd. Sofia, Bulgaria www.ideaconsult.net Ø enanomapper database: data model, technology; NANoREG data transfer
More informationWhat is Text Mining? Sophia Ananiadou National Centre for Text Mining University of Manchester
National Centre for Text Mining www.nactem.ac.uk University of Manchester Outline Aims of text mining Text Mining steps Text Mining uses Applications 2 Aims Extract and discover knowledge hidden in text
More informationSciVerse ScienceDirect. User Guide. October SciVerse ScienceDirect. Open to accelerate science
SciVerse ScienceDirect User Guide October 2010 SciVerse ScienceDirect Open to accelerate science Welcome to SciVerse ScienceDirect: How to get the most from your subscription SciVerse ScienceDirect is
More informationAn UIMA based Tool Suite for Semantic Text Processing
An UIMA based Tool Suite for Semantic Text Processing Katrin Tomanek, Ekaterina Buyko, Udo Hahn Jena University Language & Information Engineering Lab StemNet Knowledge Management for Immunology in life
More informationVisualization and text mining of patent and non-patent data
of patent and non-patent data Anton Heijs Information Solutions Delft, The Netherlands http://www.treparel.com/ ICIC conference, Nice, France, 2008 Outline Introduction Applications on patent and non-patent
More informationText mining tools for semantically enriching the scientific literature
Text mining tools for semantically enriching the scientific literature Sophia Ananiadou Director National Centre for Text Mining School of Computer Science University of Manchester Need for enriching the
More informationGreat Migrations! Approaches to Moving your Chemistry. Michael Dippolito 2013 ChemAxon UGM Budapest
Great Migrations! Approaches to Moving your Chemistry Michael Dippolito DeltaSoft Migrations R Us ChemCart ChemCart Choose your chemistry Query, Browse, Update, Report, Analyze Accelrys Accord Accelrys
More informationBioNav: An Ontology-Based Framework to Discover Semantic Links in the Cloud of Linked Data
BioNav: An Ontology-Based Framework to Discover Semantic Links in the Cloud of Linked Data María-Esther Vidal 1, Louiqa Raschid 2, Natalia Márquez 1, Jean Carlo Rivera 1, and Edna Ruckhaus 1 1 Universidad
More informationSciVerse Scopus. 1. Scopus introduction and content coverage. 2. Scopus in comparison with Web of Science. 3. Basic functionalities of Scopus
Prepared by: Jawad Sayadi Account Manager, United Kingdom Elsevier BV Radarweg 29 1043 NX Amsterdam The Netherlands J.Sayadi@elsevier.com SciVerse Scopus SciVerse Scopus 1. Scopus introduction and content
More informationBIOLOGICAL PATHWAYS AND THE SEMANTIC WEB
BIOLOGICAL PATHWAYS AND THE SEMANTIC WEB Andra Waagmeester, Tina Kutmon, Egon Willighagen, and Alex Pico Univ. Maastricht, NL, and Gladstone Institutes, CA, USA What we will talk about today Introduc*on
More informationSBMLmerge and MIRIAM support
SBMLmerge and MIRIAM support Marvin Schulz Max Planck Institute for Molecular Genetics Biomodels.net training camp 10. 04. 2006 What exactly does SBMLmerge do? Small parts of the glycolysis SBMLmerge...
More informationTaking a view on bio-ontologies. Simon Jupp Functional Genomics Production Team ICBO, 2012 Graz, Austria
Taking a view on bio-ontologies Simon Jupp Functional Genomics Production Team ICBO, 2012 Graz, Austria Who we are European Bioinformatics Institute one of world s largest bio data and service providers
More informationCreating an Index of Hit Structures using BizInt Smart Charts for Patents
Patents & IP Sequences Clinical Trials Drug Pipelines Creating an Index of Hit Structures using BizInt Smart Charts for Patents John Willmore, VP Product Development EPO PIC Workshop, Brussels, 14 November
More informationClick the Register button in the upper right part of the screen. Click the My Settings button. Then click the Change Password link
How do I.. Instructions Register for a password Change password Find out about tested environments involving Windows, Mac, and Java Click the Register button in the upper right part of the screen. Click
More informationPresenting Eidogen/Sertanty Kinase Knowledge Base (KKB) via Dotmatics browser. Kerim Babaoglu
Presenting Eidogen/Sertanty Kinase Knowledge Base (KKB) via Dotmatics browser Kerim Babaoglu September 25 th, 2012 How we used to look at data. Accord for Excel SD file ChemDraw for Excel Spotfire ISIS
More informationMarkus Kaindl Senior Manager Semantic Data Business Owner SN SciGraph
Analytics Building business tools for the scholarly publishing domain using LOD and the ELK stack SEMANTiCS Vienna 2018 Markus Kaindl Senior Manager Semantic Data Business Owner SN SciGraph 1 Agenda (25
More informationAmerican Institute of Physics
American Institute of Physics (http://journals.aip.org/)* Founded in 1931, the American Institute of Physics (AIP) is a not-for-profit scholarly society established for the purpose of promoting the advancement
More informationAg Data Commons: Harnessing the Power of Digital Agriculture Cynthia Parr USDA ARS National Agricultural Library
Ag Data Commons: Harnessing the Power of Digital Agriculture Cynthia Parr USDA ARS National Agricultural Library Live poll at: https://pollev.com/ cyndyparr196 Problems with Public Ag Data Government Website
More informationAlternative Tools for Mining The Biomedical Literature
Yale University From the SelectedWorks of Rolando Garcia-Milian May 14, 2014 Alternative Tools for Mining The Biomedical Literature Rolando Garcia-Milian, Yale University Available at: https://works.bepress.com/rolando_garciamilian/1/
More informationIssues and Opportunities Associated with Federated Searching
Issues and Opportunities Associated with Federated Searching Grace Baysinger (graceb@stanford.edu) Head Librarian & Bibliographer Swain Chemistry & Chemical Engineering Library Stanford University Libraries
More informationQUICK USER GUIDE. UG_1_Reaxys_Quick User Guide_print_AW.indd 1
QUICK USER GUIDE UG_1_Reaxys_Quick User Guide_print_AW.indd 1 16/05/2013 16:31 CONTENTS TOPIC PAGE TOPIC PAGE Register for a password. 3 Change password. 3 Find out about tested environments involving
More informationInstruction for Reaxys database
Instruction for Reaxys database Reaxys database allow for easy literature search in the area of chemistry, biology and related Literature search can be performed on the independent ways: - literature;
More informationMetasearch Process for Transcription Targets
Step 1 Select 'Genes' This is the primary interface for the Metasearch add on to Thomson Reuters (GeneGO) platform. Metasearch allows one to make complex queries for information extraction. This document
More informationData publication and discovery with Globus
Data publication and discovery with Globus Questions and comments to outreach@globus.org The Globus data publication and discovery services make it easy for institutions and projects to establish collections,
More information<is web> Information Systems & Semantic Web University of Koblenz Landau, Germany
Information Systems & University of Koblenz Landau, Germany Semantic Search examples: Swoogle and Watson Steffen Staad credit: Tim Finin (swoogle), Mathieu d Aquin (watson) and their groups 2009-07-17
More informationThomson Reuters Graph Feed & Amazon Neptune
Thomson Reuters Graph Feed & Amazon Neptune Tutorial on how to use Amazon Neptune as a graph-database alternative to explore Thomson Reuters Graph Feed. Pratik Pandey Jan 24th, 2018 End of November last
More informationSemantic Enrichment ARMA Chicago Spring Seminar April 18, 2018
Semantic Enrichment ARMA Chicago Spring Seminar April 18, 2018 Presentation Overview What is Semantics? Semantic Building Blocks Why Use Semantic Technology Semantic Layers Source of Semantic Information
More informationAmbitXT v2.1.0 Manual
AmbitXT v2.1.0 Manual June 2009 1 Table of Contents Introduction... 2 Functions of AMBIT XT v2.1.0... 2 Workflow of AMBIT XT v2.1.0... 3 Using Database Utilities... 4 General Information... 4 Prerequisite
More informationTaxonomy Tools: Collaboration, Creation & Integration. Dow Jones & Company
Taxonomy Tools: Collaboration, Creation & Integration Dave Clarke Global Taxonomy Director dave.clarke@dowjones.com Dow Jones & Company Introduction Software Tools for Taxonomy 1. Collaboration 2. Creation
More informationHow to contribute information to AGRIS
How to contribute information to AGRIS Guidelines on how to complete your registration form The dashboard includes information about you, your institution and your collection. You are welcome to provide
More information