!"#$ Gribskov Profile. Hidden Markov Models. Building an Hidden Markov Model. Proteins, DNA and other genomic features can be
|
|
- Dale Reynolds
- 5 years ago
- Views:
Transcription
1 Gribskov Profile $ Hidden Markov Models Building an Hidden Markov Model $ Proteins, DN and other genomic features can be classified into families of related sequences and structures $ Related sequences can diverge beyond recognition with standard sequence comparison methods How to detect these similarities: $ $ POS D E F G H L S T Gap 3 6 What is a Gribskov Profile? $ $ Differences between Gribskov Profiles and common sequence comparison methods %& What is needed to create a Gribskov Profile? seqpep ~GTL seqpep GGSL~ seq3pep ~GHSV seqpep ~GGTL seqpep GSS~ ( % + +,-
2 & / seqpep ~GTL seqpep GGSL~ seq3pep ~GHSV seqpep ~GGTL seqpep GSS~ The profile is filled using the 0 M (p,a = b= W (p,b (a,b D E W Gap W (p,b = n(b,p/ N R (a,b /0 /0 67 /70 89 /70 B D E F G H I K L M N P Q R S T V W X Z B D E - - F G H I K L M N P Q R S T V W X Z W The profile is filled using the W (p,b 7 = n(b,p/ N R (a,b /0 0 M (p,a = b= W (p,b (a,b /0 67 /70 89 /70 9 /70 6&+ 0 M (p,a = b= W (p,b (a,b M (, = b= W (,b (,b M (, = ( W (, (, + (W (, (, ++ ( W (, (, M (, = ( 00/ + ( / 0 M (, = b= W (,b (,b ++ ( 00/ - seqpep ~GTL seqpep GGSL~ seq3pep ~GHSV seqpep ~GGTL seqpep GSS~ $-/-+,: POS D E F G H L S T Gap seqpep ~GTL seqpep GGSL~ seq3pep ~GHSV seqpep ~GGTL seqpep GSS~ %;06 0< + 0< 0< 0<, %0< ;0 Probability of any sequence is calculated in the sa me way POS D E F G H L S T Gap
3 ProfileMake ProfileGap ProfileSearch ProfileSegments TProfileGap TProfileSearch TProfileSegments =7 =7 Gribskov Profile $ Hidden Markov Models Building an Hidden Markov Model Markov Models are probabilistic, models, with a solid statistical foundation In contrast to patterns and profiles, HMMs allow consistent treatment of insertions and deletions P=06 P=0 P=0 P=009 P=00 T G - Domain (active binding site Domain (never found, inactive Domain 3 (never found, inactive Domain (active TGTGTGTG TGTGGTGTG TGTTGTG TGTGTGTG (/ %0 63- In contrast to patterns and profiles, Markov Models take into account the information about neighboring residues (%/ 0, 6-3,/0, 6-3, (,/ 0 6-3,/0 6-3, (,/ 0 6-3,/0 6-3, (/ %0 > 63- (/ %0 > 63- Markov Models take into account additional information about neighboring residues First order Markov Model Fifth order Markov Model / %?0 Gene finding Protein secondary structure prediction Protein homology recognition Phylogenetic analysis Radiation hybrid mapping Profile HMM libraries Genetic linkage mapping +, +$ + -% % / ( $ & 03+
4 ,77 6,778 : D E F G H I D E F G H I D E F G H I : 9 : P(sequence is the product of the emission and transition probabilties ny sequence can be represented by a path through the model :;<:9 8:;<:: & & ( & & ( $( $ ( $ $ +,-($$$ $( $( $ $ ( ( $ Different state paths through the model can generate the same sequence orrect probability of a sequence
5 Forward lgorithm This solution is computationally unfeasible for long sequences Viterbi lgorithm / /-$ $ & & $ ( ( $( $( $( & ( $ $ $ ( $ $ ( & $ $ +, 0-- +, -$$(-$ +, +, -($-$$( +, -(- +, -$$-$$$ +, -- $ & ($ & ($ ($ & & $ $ ( ( $( ($ ( $ $( ($ + $( $ & & +,-+, 0 +, 3+, ( +, ( +, 3+, ( $ $ $ $ $ The score that a sequence obtains with an HMM measures the probability of that sequence to belong to a family, group, class +, -+, $ +, -+, 3+, +, -+, +, -+, 3+, +, -+, 3+, +, -$+, +, -+, Global scoring Local scoring The alignment type is part of the model and must be specified before creating the HMM and not when using it Gribskov Profile ; </ Hidden Markov Models Building an Hidden Markov Model : HMM can be estimated from sequences 8 Sequences used to estimate or train the model are called Training data seqpep ~GTL seqpep GGSL~ seq3pep ~GHSV seqpep ~GGTL seqpep GSS~
6 To build an HMM is necessary to estimate == e k (b=e k (b/ b E k (b >?0@? seqpep ~GTL seqpep GGSL~ seq3pep ~GHSV seqpep ~GGTL seqpep GSS~ < The expected transition probability is calcuated the same way a kl (b= kl (b/ l E kl (b +, Model overspecialization /= crd XFTNVSTTSKEWSVQRLHNTSGRGKMMK bah XFTNVSXTTSKEWSVQRLHNTSGRGKMXMK Sequence weighting < % ; / 7 = sxm TIINVKTSPKQSKPKELGSSGaKMNGK lir XFTQESTSNQWSIRRLHNTNRGKMNSK mbt XFTNVSSSSQWPVKKLFGTRGKINGK Sequence weighting based on ;@ $ ( / // -3-3 Model overspecialization --$ --$ Model overspecialization Model overspecialization Position-specific weighting method (Henikoff? <? Maximum discrimination / / % / / crd XFTNVSTTSKEWSVQRLHNT bah XFTNVSXTTSKEWSVQRLHNT sxm TIINVKTSPKQSKPKELGS lir XFTQESTSNQWSIRRLHNT mbt XFTNVSSSSQWPVKKLFGT (
7 Overfitting $ $%& caused by insufficient training data ($$( Regularization using prior information +$, $, - $, - +( -$ $%( / % /0 -$ $%( % /0 but usually ( ++ 3(( -$,,$ ( Baum-Welch lgorithm, ( 6 ( $ % $ Baum-Welch lgorithm $ ( $ $ 6 Iterative algorithm which maximizes the probability of the training sequences in the model Maximizes the likelihood of the model That it is the joint probability of all sequences in the training set given a particular set of parameters $ (, 3 $ $ $ $, ( 6 $ $ ( greater variation little variation onvergence void a local maximum Use of heuristic methods 7, 8,( 6 -$ $ ($ $ (,( Gene finding Protein secondary structure prediction Protein homology recognition Phylogenetic analysis Radiation hybrid mapping Profile HMM libraries Genetic linkage mapping & -03 ( (,% ( 6$ 0$-(7+ & (+ &,:(+ &/ 0 (+ & (+ &89+ &, -$(+
8 HMMalign HMMBuild HMMconvert HMMemit TMhmm Genescan HMM scan HMMsearch $ %& ( For gene finding several signals must be recognized and combined into a prediction of exons and introns : : % ( % ;< % ; $ % % n HMM for unspliced genes n HMM for spliced genes : % :: % x xxxxxxxxtgccc ccc ccctxxxxxxxx + % < < needed to use three different models of introns for each reading frame Four models are combined together using Viterbi algorithm to find the most probable pathway 9 - %% n HMM for spliced genes $ $ GTxxxxxx interior intron xxxxxxg GTxxxxxx interior intron xxxxxxg +, GTxxxxxx interior intron xxxxxxg, + %% ll models are combined together using Viterbi algorithm to find the most probable pathway
Gribskov Profile. Hidden Markov Models. Building a Hidden Markov Model #$ %&
Gribskov Profile #$ %& Hidden Markov Models Building a Hidden Markov Model "! Proteins, DNA and other genomic features can be classified into families of related sequences and structures How to detect
More informationHIDDEN MARKOV MODELS AND SEQUENCE ALIGNMENT
HIDDEN MARKOV MODELS AND SEQUENCE ALIGNMENT - Swarbhanu Chatterjee. Hidden Markov models are a sophisticated and flexible statistical tool for the study of protein models. Using HMMs to analyze proteins
More informationBiology 644: Bioinformatics
A statistical Markov model in which the system being modeled is assumed to be a Markov process with unobserved (hidden) states in the training data. First used in speech and handwriting recognition In
More information15-780: Graduate Artificial Intelligence. Computational biology: Sequence alignment and profile HMMs
5-78: Graduate rtificial Intelligence omputational biology: Sequence alignment and profile HMMs entral dogma DN GGGG transcription mrn UGGUUUGUG translation Protein PEPIDE 2 omparison of Different Organisms
More informationMachine Learning. Computational biology: Sequence alignment and profile HMMs
10-601 Machine Learning Computational biology: Sequence alignment and profile HMMs Central dogma DNA CCTGAGCCAACTATTGATGAA transcription mrna CCUGAGCCAACUAUUGAUGAA translation Protein PEPTIDE 2 Growth
More informationProfiles and Multiple Alignments. COMP 571 Luay Nakhleh, Rice University
Profiles and Multiple Alignments COMP 571 Luay Nakhleh, Rice University Outline Profiles and sequence logos Profile hidden Markov models Aligning profiles Multiple sequence alignment by gradual sequence
More informationQuiz Section Week 8 May 17, Machine learning and Support Vector Machines
Quiz Section Week 8 May 17, 2016 Machine learning and Support Vector Machines Another definition of supervised machine learning Given N training examples (objects) {(x 1,y 1 ), (x 2,y 2 ),, (x N,y N )}
More informationLecture 5: Markov models
Master s course Bioinformatics Data Analysis and Tools Lecture 5: Markov models Centre for Integrative Bioinformatics Problem in biology Data and patterns are often not clear cut When we want to make a
More informationGenome 559. Hidden Markov Models
Genome 559 Hidden Markov Models A simple HMM Eddy, Nat. Biotech, 2004 Notes Probability of a given a state path and output sequence is just product of emission/transition probabilities If state path is
More informationHMMConverter A tool-box for hidden Markov models with two novel, memory efficient parameter training algorithms
HMMConverter A tool-box for hidden Markov models with two novel, memory efficient parameter training algorithms by TIN YIN LAM B.Sc., The Chinese University of Hong Kong, 2006 A THESIS SUBMITTED IN PARTIAL
More informationStephen Scott.
1 / 33 sscott@cse.unl.edu 2 / 33 Start with a set of sequences In each column, residues are homolgous Residues occupy similar positions in 3D structure Residues diverge from a common ancestral residue
More informationPROTEIN MULTIPLE ALIGNMENT MOTIVATION: BACKGROUND: Marina Sirota
Marina Sirota MOTIVATION: PROTEIN MULTIPLE ALIGNMENT To study evolution on the genetic level across a wide range of organisms, biologists need accurate tools for multiple sequence alignment of protein
More informationUsing Hidden Markov Models to Detect DNA Motifs
San Jose State University SJSU ScholarWorks Master's Projects Master's Theses and Graduate Research Spring 5-13-2015 Using Hidden Markov Models to Detect DNA Motifs Santrupti Nerli San Jose State University
More informationCISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment
CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features
More informationGLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment
GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment Scoring Dynamic Programming algorithms Heuristic algorithms CLUSTAL W Courtesy of jalview Motivations Collective (or aggregate) statistic
More informationMultiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences
Multiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences Yue Lu and Sing-Hoi Sze RECOMB 2007 Presented by: Wanxing Xu March 6, 2008 Content Biology Motivation Computation Problem
More informationECE521: Week 11, Lecture March 2017: HMM learning/inference. With thanks to Russ Salakhutdinov
ECE521: Week 11, Lecture 20 27 March 2017: HMM learning/inference With thanks to Russ Salakhutdinov Examples of other perspectives Murphy 17.4 End of Russell & Norvig 15.2 (Artificial Intelligence: A Modern
More informationNew String Kernels for Biosequence Data
Workshop on Kernel Methods in Bioinformatics New String Kernels for Biosequence Data Christina Leslie Department of Computer Science Columbia University Biological Sequence Classification Problems Protein
More informationEukaryotic Gene Finding: The GENSCAN System
Eukaryotic Gene Finding: The GENSCAN System BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2016 Anthony Gitter gitter@biostat.wisc.edu These slides, excluding third-party material, are licensed under CC
More informationMultiple Sequence Alignment Gene Finding, Conserved Elements
Multiple Sequence Alignment Gene Finding, Conserved Elements Definition Given N sequences x 1, x 2,, x N : Insert gaps (-) in each sequence x i, such that All sequences have the same length L Score of
More informationIntroduction to SLAM Part II. Paul Robertson
Introduction to SLAM Part II Paul Robertson Localization Review Tracking, Global Localization, Kidnapping Problem. Kalman Filter Quadratic Linear (unless EKF) SLAM Loop closing Scaling: Partition space
More informationHidden Markov Models. Mark Voorhies 4/2/2012
4/2/2012 Searching with PSI-BLAST 0 th order Markov Model 1 st order Markov Model 1 st order Markov Model 1 st order Markov Model What are Markov Models good for? Background sequence composition Spam Hidden
More informationQuiz section 10. June 1, 2018
Quiz section 10 June 1, 2018 Logistics Bring: 1 page cheat-sheet, simple calculator Any last logistics questions about the final? Logistics Bring: 1 page cheat-sheet, simple calculator Any last logistics
More informationBMI/CS Lecture #22 - Stochastic Context Free Grammars for RNA Structure Modeling. Colin Dewey (adapted from slides by Mark Craven)
BMI/CS Lecture #22 - Stochastic Context Free Grammars for RNA Structure Modeling Colin Dewey (adapted from slides by Mark Craven) 2007.04.12 1 Modeling RNA with Stochastic Context Free Grammars consider
More informationMotivation: Shortcomings of Hidden Markov Model. Ko, Youngjoong. Solution: Maximum Entropy Markov Model (MEMM)
Motivation: Shortcomings of Hidden Markov Model Maximum Entropy Markov Models and Conditional Random Fields Ko, Youngjoong Dept. of Computer Engineering, Dong-A University Intelligent System Laboratory,
More informationHidden Markov Models. Slides adapted from Joyce Ho, David Sontag, Geoffrey Hinton, Eric Xing, and Nicholas Ruozzi
Hidden Markov Models Slides adapted from Joyce Ho, David Sontag, Geoffrey Hinton, Eric Xing, and Nicholas Ruozzi Sequential Data Time-series: Stock market, weather, speech, video Ordered: Text, genes Sequential
More informationChapter 8 Multiple sequence alignment. Chaochun Wei Spring 2018
1896 1920 1987 2006 Chapter 8 Multiple sequence alignment Chaochun Wei Spring 2018 Contents 1. Reading materials 2. Multiple sequence alignment basic algorithms and tools how to improve multiple alignment
More informationChapter 6. Multiple sequence alignment (week 10)
Course organization Introduction ( Week 1,2) Part I: Algorithms for Sequence Analysis (Week 1-11) Chapter 1-3, Models and theories» Probability theory and Statistics (Week 3)» Algorithm complexity analysis
More informationAs of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be
48 Bioinformatics I, WS 09-10, S. Henz (script by D. Huson) November 26, 2009 4 BLAST and BLAT Outline of the chapter: 1. Heuristics for the pairwise local alignment of two sequences 2. BLAST: search and
More informationFinding data. HMMER Answer key
Finding data HMMER Answer key HMMER input is prepared using VectorBase ClustalW, which runs a Java application for the graphical representation of the results. If you get an error message that blocks this
More informationMSCBIO 2070/02-710: Computational Genomics, Spring A4: spline, HMM, clustering, time-series data analysis, RNA-folding
MSCBIO 2070/02-710:, Spring 2015 A4: spline, HMM, clustering, time-series data analysis, RNA-folding Due: April 13, 2015 by email to Silvia Liu (silvia.shuchang.liu@gmail.com) TA in charge: Silvia Liu
More informationSupport Vector Machine Learning for Interdependent and Structured Output Spaces
Support Vector Machine Learning for Interdependent and Structured Output Spaces I. Tsochantaridis, T. Hofmann, T. Joachims, and Y. Altun, ICML, 2004. And also I. Tsochantaridis, T. Joachims, T. Hofmann,
More informationUsing Hidden Markov Models for Multiple Sequence Alignments Lab #3 Chem 389 Kelly M. Thayer
Página 1 de 10 Using Hidden Markov Models for Multiple Sequence Alignments Lab #3 Chem 389 Kelly M. Thayer Resources: Bioinformatics, David Mount Ch. 4 Multiple Sequence Alignments http://www.netid.com/index.html
More informationStructured Learning. Jun Zhu
Structured Learning Jun Zhu Supervised learning Given a set of I.I.D. training samples Learn a prediction function b r a c e Supervised learning (cont d) Many different choices Logistic Regression Maximum
More informationExpectation Maximization. Machine Learning 10701/15781 Carlos Guestrin Carnegie Mellon University
Expectation Maximization Machine Learning 10701/15781 Carlos Guestrin Carnegie Mellon University April 10 th, 2006 1 Announcements Reminder: Project milestone due Wednesday beginning of class 2 Coordinate
More informationModeling time series with hidden Markov models
Modeling time series with hidden Markov models Advanced Machine learning 2017 Nadia Figueroa, Jose Medina and Aude Billard Time series data Barometric pressure Temperature Data Humidity Time What s going
More information3.4 Multiple sequence alignment
3.4 Multiple sequence alignment Why produce a multiple sequence alignment? Using more than two sequences results in a more convincing alignment by revealing conserved regions in ALL of the sequences Aligned
More informationConditional Random Fields and beyond D A N I E L K H A S H A B I C S U I U C,
Conditional Random Fields and beyond D A N I E L K H A S H A B I C S 5 4 6 U I U C, 2 0 1 3 Outline Modeling Inference Training Applications Outline Modeling Problem definition Discriminative vs. Generative
More informationCS 6784 Paper Presentation
Conditional Random Fields: Probabilistic Models for Segmenting and Labeling Sequence Data John La erty, Andrew McCallum, Fernando C. N. Pereira February 20, 2014 Main Contributions Main Contribution Summary
More informationHidden Markov Models in the context of genetic analysis
Hidden Markov Models in the context of genetic analysis Vincent Plagnol UCL Genetics Institute November 22, 2012 Outline 1 Introduction 2 Two basic problems Forward/backward Baum-Welch algorithm Viterbi
More informationExercise 2: Browser-Based Annotation and RNA-Seq Data
Exercise 2: Browser-Based Annotation and RNA-Seq Data Jeremy Buhler July 24, 2018 This exercise continues your introduction to practical issues in comparative annotation. You ll be annotating genomic sequence
More informationBrief review from last class
Sequence Alignment Brief review from last class DNA is has direction, we will use only one (5 -> 3 ) and generate the opposite strand as needed. DNA is a 3D object (see lecture 1) but we will model it
More informationBLAST, Profile, and PSI-BLAST
BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources
More informationDocumentation of HMMEditor 1.0
Documentation of HMMEditor 1.0 HMMEditor 1.0 stands for profile Hidden Markov Model (phmm) Visual Editor. It is a tool to visualize and edit phmm in HMMer format. HMMer format is also used by Pfam protein
More informationDynamic Time Warping
Centre for Vision Speech & Signal Processing University of Surrey, Guildford GU2 7XH. Dynamic Time Warping Dr Philip Jackson Acoustic features Distance measures Pattern matching Distortion penalties DTW
More informationOptimization of Hidden Markov Model by a Genetic Algorithm for Web Information Extraction
Optimization of Hidden Markov Model by a Genetic Algorithm for Web Information Extraction Jiyi Xiao Lamei Zou Chuanqi Li School of Computer Science and Technology, University of South China, Hengyang 421001,
More informationComparison of Phylogenetic Trees of Multiple Protein Sequence Alignment Methods
Comparison of Phylogenetic Trees of Multiple Protein Sequence Alignment Methods Khaddouja Boujenfa, Nadia Essoussi, and Mohamed Limam International Science Index, Computer and Information Engineering waset.org/publication/482
More informationUsing Hidden Markov Models to analyse time series data
Using Hidden Markov Models to analyse time series data September 9, 2011 Background Want to analyse time series data coming from accelerometer measurements. 19 different datasets corresponding to different
More informationA Hidden Markov Model for Alphabet Soup Word Recognition
A Hidden Markov Model for Alphabet Soup Word Recognition Shaolei Feng 1 Nicholas R. Howe 2 R. Manmatha 1 1 University of Massachusetts, Amherst 2 Smith College Motivation: Inaccessible Treasures Historical
More informationNOVEL HYBRID GENETIC ALGORITHM WITH HMM BASED IRIS RECOGNITION
NOVEL HYBRID GENETIC ALGORITHM WITH HMM BASED IRIS RECOGNITION * Prof. Dr. Ban Ahmed Mitras ** Ammar Saad Abdul-Jabbar * Dept. of Operation Research & Intelligent Techniques ** Dept. of Mathematics. College
More informationComparing the Bidirectional Baum-Welch Algorithm and the Baum-Welch Algorithm on Regular Lattice
Comparing the Bidirectional Baum-Welch Algorithm and the Baum-Welch Algorithm on Regular Lattice Vahid Rezaei 1, 4,Sima Naghizadeh 2, Hamid Pezeshk 3, 4, *, Mehdi Sadeghi 5 and Changiz Eslahchi 6 1 Department
More informationIntroduction to Unix/Linux INX_S17, Day 6,
Introduction to Unix/Linux INX_S17, Day 6, 2017-04-17 Installing binaries, uname, hmmer and muscle, public data (wget and sftp) Learning Outcome(s): Install and run software from your home directory. Download
More informationA multiple alignment tool in 3D
Outline Department of Computer Science, Bioinformatics Group University of Leipzig TBI Winterseminar Bled, Slovenia February 2005 Outline Outline 1 Multiple Alignments Problems Goal Outline Outline 1 Multiple
More informationAn Introduction to Hidden Markov Models
An Introduction to Hidden Markov Models Max Heimel Fachgebiet Datenbanksysteme und Informationsmanagement Technische Universität Berlin http://www.dima.tu-berlin.de/ 07.10.2010 DIMA TU Berlin 1 Agenda
More informationCS273: Algorithms for Structure Handout # 4 and Motion in Biology Stanford University Thursday, 8 April 2004
CS273: Algorithms for Structure Handout # 4 and Motion in Biology Stanford University Thursday, 8 April 2004 Lecture #4: 8 April 2004 Topics: Sequence Similarity Scribe: Sonil Mukherjee 1 Introduction
More informationFaster Gradient Descent Training of Hidden Markov Models, Using Individual Learning Rate Adaptation
Faster Gradient Descent Training of Hidden Markov Models, Using Individual Learning Rate Adaptation Pantelis G. Bagos, Theodore D. Liakopoulos, and Stavros J. Hamodrakas Department of Cell Biology and
More informationInvariant Recognition of Hand-Drawn Pictograms Using HMMs with a Rotating Feature Extraction
Invariant Recognition of Hand-Drawn Pictograms Using HMMs with a Rotating Feature Extraction Stefan Müller, Gerhard Rigoll, Andreas Kosmala and Denis Mazurenok Department of Computer Science, Faculty of
More informationFeature Selection. CE-725: Statistical Pattern Recognition Sharif University of Technology Spring Soleymani
Feature Selection CE-725: Statistical Pattern Recognition Sharif University of Technology Spring 2013 Soleymani Outline Dimensionality reduction Feature selection vs. feature extraction Filter univariate
More informationMultiple Sequence Alignment. Mark Whitsitt - NCSA
Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV
More informationHidden Markov Models. Gabriela Tavares and Juri Minxha Mentor: Taehwan Kim CS159 04/25/2017
Hidden Markov Models Gabriela Tavares and Juri Minxha Mentor: Taehwan Kim CS159 04/25/2017 1 Outline 1. 2. 3. 4. Brief review of HMMs Hidden Markov Support Vector Machines Large Margin Hidden Markov Models
More informationGenome 559: Introduction to Statistical and Computational Genomics. Lecture15a Multiple Sequence Alignment Larry Ruzzo
Genome 559: Introduction to Statistical and Computational Genomics Lecture15a Multiple Sequence Alignment Larry Ruzzo 1 Multiple Alignment: Motivations Common structure, function, or origin may be only
More informationDet De e t cting abnormal event n s Jaechul Kim
Detecting abnormal events Jaechul Kim Purpose Introduce general methodologies used in abnormality detection Deal with technical details of selected papers Abnormal events Easy to verify, but hard to describe
More informationJET 2 User Manual 1 INSTALLATION 2 EXECUTION AND FUNCTIONALITIES. 1.1 Download. 1.2 System requirements. 1.3 How to install JET 2
JET 2 User Manual 1 INSTALLATION 1.1 Download The JET 2 package is available at www.lcqb.upmc.fr/jet2. 1.2 System requirements JET 2 runs on Linux or Mac OS X. The program requires some external tools
More information8/19/13. Computational problems. Introduction to Algorithm
I519, Introduction to Introduction to Algorithm Yuzhen Ye (yye@indiana.edu) School of Informatics and Computing, IUB Computational problems A computational problem specifies an input-output relationship
More informationGenome Browser. Background and Strategy. 12 April 2010
Genome Browser Background and Strategy 12 April 2010 I. Background 1. Project definition 2. Survey of genome browsers II. Strategy Alejandro Caro, Chandni Desai, Neha Gupta, Jay Humphrey, Chengwei Luo,
More informationParallel HMMs. Parallel Implementation of Hidden Markov Models for Wireless Applications
Parallel HMMs Parallel Implementation of Hidden Markov Models for Wireless Applications Authors Shawn Hymel (Wireless@VT, Virginia Tech) Ihsan Akbar (Harris Corporation) Jeffrey Reed (Wireless@VT, Virginia
More informationSemi-Supervised Learning of Named Entity Substructure
Semi-Supervised Learning of Named Entity Substructure Alden Timme aotimme@stanford.edu CS229 Final Project Advisor: Richard Socher richard@socher.org Abstract The goal of this project was two-fold: (1)
More informationEfficient Implementation of a Generalized Pair HMM for Comparative Gene Finding. B. Majoros M. Pertea S.L. Salzberg
Efficient Implementation of a Generalized Pair HMM for Comparative Gene Finding B. Majoros M. Pertea S.L. Salzberg ab initio gene finder genome 1 MUMmer Whole-genome alignment (optional) ROSE Region-Of-Synteny
More informationPosterior Decoding Methods for Optimization and Accuracy Control of Multiple Alignments
Posterior Decoding Methods for Optimization and Accuracy Control of Multiple Alignments Ariel Shaul Schwartz Electrical Engineering and Computer Sciences University of California at Berkeley Technical
More informationHMM-Based Handwritten Amharic Word Recognition with Feature Concatenation
009 10th International Conference on Document Analysis and Recognition HMM-Based Handwritten Amharic Word Recognition with Feature Concatenation Yaregal Assabie and Josef Bigun School of Information Science,
More informationDynamic Bayesian network (DBN)
Readings: K&F: 18.1, 18.2, 18.3, 18.4 ynamic Bayesian Networks Beyond 10708 Graphical Models 10708 Carlos Guestrin Carnegie Mellon University ecember 1 st, 2006 1 ynamic Bayesian network (BN) HMM defined
More informationSequence analysis Pairwise sequence alignment
UMF11 Introduction to bioinformatics, 25 Sequence analysis Pairwise sequence alignment 1. Sequence alignment Lecturer: Marina lexandersson 12 September, 25 here are two types of sequence alignments, global
More informationConditional Random Fields. Mike Brodie CS 778
Conditional Random Fields Mike Brodie CS 778 Motivation Part-Of-Speech Tagger 2 Motivation object 3 Motivation I object! 4 Motivation object Do you see that object? 5 Motivation Part-Of-Speech Tagger -
More informationMismatch String Kernels for SVM Protein Classification
Mismatch String Kernels for SVM Protein Classification by C. Leslie, E. Eskin, J. Weston, W.S. Noble Athina Spiliopoulou Morfoula Fragopoulou Ioannis Konstas Outline Definitions & Background Proteins Remote
More informationPackage HMMCont. February 19, 2015
Type Package Package HMMCont February 19, 2015 Title Hidden Markov Model for Continuous Observations Processes Version 1.0 Date 2014-02-11 Author Maintainer The package includes
More informationSemi-supervised protein classification using cluster kernels
Semi-supervised protein classification using cluster kernels Jason Weston Max Planck Institute for Biological Cybernetics, 72076 Tübingen, Germany weston@tuebingen.mpg.de Dengyong Zhou, Andre Elisseeff
More informationHidden Markov Model for Sequential Data
Hidden Markov Model for Sequential Data Dr.-Ing. Michelle Karg mekarg@uwaterloo.ca Electrical and Computer Engineering Cheriton School of Computer Science Sequential Data Measurement of time series: Example:
More informationHidden Markov Models Review and Applications. hidden Markov model. what we see model M = (,Q,T) states Q transition probabilities e Ax
Hidden Markov Models Review and Applications 1 hidden Markov model what we see x y model M = (,Q,T) states Q transition probabilities e Ax t AA e Ay observation observe states indirectly emission probabilities
More informationDISCRETE HIDDEN MARKOV MODEL IMPLEMENTATION
DIGITAL SPEECH PROCESSING HOMEWORK #1 DISCRETE HIDDEN MARKOV MODEL IMPLEMENTATION Date: March, 28 2018 Revised by Ju-Chieh Chou 2 Outline HMM in Speech Recognition Problems of HMM Training Testing File
More informationExercise 5. Deadlines: Monday (final, no student correction) Matlabs Statistics Toolbox contains the following functions for HMM :
Exercise 5 Deadlines: Monday 2008.10.06 (final, no student correction) Write, comment and hand in a script that performs tasks 2-7 in this exercise (preferably by email to xffhello@gmail.com). Use comments
More informationShort Read Alignment. Mapping Reads to a Reference
Short Read Alignment Mapping Reads to a Reference Brandi Cantarel, Ph.D. & Daehwan Kim, Ph.D. BICF 05/2018 Introduction to Mapping Short Read Aligners DNA vs RNA Alignment Quality Pitfalls and Improvements
More informationWilson Leung 01/03/2018 An Introduction to NCBI BLAST. Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment
An Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at https://blast.ncbi.nlm.nih.gov/blast.cgi
More informationAlignments BLAST, BLAT
Alignments BLAST, BLAT Genome Genome Gene vs Built of DNA DNA Describes Organism Protein gene Stored as Circular/ linear Single molecule, or a few of them Both (depending on the species) Part of genome
More informationMismatch String Kernels for SVM Protein Classification
Mismatch String Kernels for SVM Protein Classification Christina Leslie Department of Computer Science Columbia University cleslie@cs.columbia.edu Jason Weston Max-Planck Institute Tuebingen, Germany weston@tuebingen.mpg.de
More information18 October, 2013 MVA ENS Cachan. Lecture 6: Introduction to graphical models Iasonas Kokkinos
Machine Learning for Computer Vision 1 18 October, 2013 MVA ENS Cachan Lecture 6: Introduction to graphical models Iasonas Kokkinos Iasonas.kokkinos@ecp.fr Center for Visual Computing Ecole Centrale Paris
More informationapplication of learning vector quantization algorithms. In Proceedings of the International Joint Conference on
[5] Teuvo Kohonen. The Self-Organizing Map. In Proceedings of the IEEE, pages 1464{1480, 1990. [6] Teuvo Kohonen, Jari Kangas, Jorma Laaksonen, and Kari Torkkola. LVQPAK: A program package for the correct
More informationBasics of Multiple Sequence Alignment
Basics of Multiple Sequence Alignment Tandy Warnow February 10, 2018 Basics of Multiple Sequence Alignment Tandy Warnow Basic issues What is a multiple sequence alignment? Evolutionary processes operating
More informationPrinciples of Bioinformatics. BIO540/STA569/CSI660 Fall 2010
Principles of Bioinformatics BIO540/STA569/CSI660 Fall 2010 Lecture 11 Multiple Sequence Alignment I Administrivia Administrivia The midterm examination will be Monday, October 18 th, in class. Closed
More informationSequence alignment algorithms
Sequence alignment algorithms Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 23 rd 27 After this lecture, you can decide when to use local and global sequence alignments
More informationDynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014
Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into
More informationStructured Perceptron. Ye Qiu, Xinghui Lu, Yue Lu, Ruofei Shen
Structured Perceptron Ye Qiu, Xinghui Lu, Yue Lu, Ruofei Shen 1 Outline 1. 2. 3. 4. Brief review of perceptron Structured Perceptron Discriminative Training Methods for Hidden Markov Models: Theory and
More informationINF4820, Algorithms for AI and NLP: Hierarchical Clustering
INF4820, Algorithms for AI and NLP: Hierarchical Clustering Erik Velldal University of Oslo Sept. 25, 2012 Agenda Topics we covered last week Evaluating classifiers Accuracy, precision, recall and F-score
More informationTutorial for the Exon Ontology website
Tutorial for the Exon Ontology website Table of content Outline Step-by-step Guide 1. Preparation of the test-list 2. First analysis step (without statistical analysis) 2.1. The output page is composed
More informationPreliminary Syllabus. Genomics. Introduction & Genome Assembly Sequence Comparison Gene Modeling Gene Function Identification
Preliminary Syllabus Sep 30 Oct 2 Oct 7 Oct 9 Oct 14 Oct 16 Oct 21 Oct 25 Oct 28 Nov 4 Nov 8 Introduction & Genome Assembly Sequence Comparison Gene Modeling Gene Function Identification OCTOBER BREAK
More informationk-means demo Administrative Machine learning: Unsupervised learning" Assignment 5 out
Machine learning: Unsupervised learning" David Kauchak cs Spring 0 adapted from: http://www.stanford.edu/class/cs76/handouts/lecture7-clustering.ppt http://www.youtube.com/watch?v=or_-y-eilqo Administrative
More informationMultiple sequence alignment. November 20, 2018
Multiple sequence alignment November 20, 2018 Why do multiple alignment? Gain insight into evolutionary history Can assess time of divergence by looking at the number of mutations needed to change one
More informationWilson Leung 05/27/2008 A Simple Introduction to NCBI BLAST
A Simple Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at http://www.ncbi.nih.gov/blast/
More informationCSCI 5582 Artificial Intelligence. Today 10/31
CSCI 5582 Artificial Intelligence Lecture 17 Jim Martin Today 10/31 HMM Training (EM) Break Machine Learning 1 Urns and Balls Π Urn 1: 0.9; Urn 2: 0.1 A Urn 1 Urn 2 Urn 1 Urn 2 0.6 0.3 0.4 0.7 B Urn 1
More informationε-machine Estimation and Forecasting
ε-machine Estimation and Forecasting Comparative Study of Inference Methods D. Shemetov 1 1 Department of Mathematics University of California, Davis Natural Computation, 2014 Outline 1 Motivation ε-machines
More informationCISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Sequence pairwise alignment Score statistics: E-value and p-value Heuristic algorithms: BLAST and FASTA Database search: gene finding and annotations
More information