Multiple Sequence Alignments
|
|
- Lillian Jenkins
- 6 years ago
- Views:
Transcription
1 Multiple Sequence Alignments
2 Pair-wise Alignments Blast and FASTA first find small high-scoring alignments to build words which are used as a starting points for alignments Blast words default size is 3 for proteins and 11 for nucleotides GATGAGTATGCTCGTACCTGTAATGTAGTGTATAGTACATGCA GAAGACTATGCTCGTACCTCTAATGTAG TACATGCA GTACATGCA G TA CATGCA Affine gaps
3 Progressive Multiple Sequence Alignment 1. First pairwise alignments of each sequence are made to form a guide tree 2. Guide tree is used to progressively add sequences to the alignment beginning with the most closely related and continuing until the most distant A B C D E F G 1. A with B ---> alignment AB 2. C with D ---> alignment CD 3. AB with CD ---> alignment ABCD 4. ABCD with E---> ABCDE 5. ABCDE with F ---> ABCDEF 6. ABCDEF with G ---> ABCDEFG Pros: Cons: Relatively fast Alignment errors early in the progression will be carried throughout the entire process Instant Notes Bioinformatics
4 ClustalW ClustalW is a Multiple Sequence Alignment (MSA) program for DNA or protein sequences. It produces biologically meaningful multiple sequence alignments of divergent sequences. You need to create gulo_aa.fa using these NP_ accessions saved in a file and run your script from last week. NP_ NP_ NP_ NP_ sudo apt get install clustalw phylip clustalw infile=gulo_aa.fa type=protein clustalw infile=gulo_aa.aln tree output=phylip # look at the.ph file, this is a standard text format used for a phylogenetic tree # now use phylip to draw an diagram of your phylogenetic tree phylip drawgram enter gulo_aa.ph when prompted. S to change tree style phylip retree
5 Create a single Perl script to create a Phylogenetic Tree 1. Read in a file that is a single column of NCBI accessions. 2. Use BioPerl to create a file of FASTA formatted sequences for the accessions 3. Use PRANK to perform a multiple alignment of the sequences in the file from step Use R to create a.jpg image of the phylogenetic tree of your sequence alignment. Perl pipeline script BioPerl PRANK R accessions_file seqs.fa alignment.dnd.jpg image
6 PRANK Prank is a multiple sequence alignment application that first performs pairwise alignments of each sequence to form a multiple alignment. Then it generates a new guide tree based on this first alignment and makes a second, more improved alignment Search the web for prank alignment download, unzip and install sudo apt get install g++ tar xzf prank.src tgz cd prank sudo make sudo cp prank /usr/local/bin prank gulo_aa.fa #install g++ compiler #copy prank to UNIX path #command to run prank First Alignment Output Files: output.1.dnd output.1.fas output.1.xml file for constructing graphical tree fasta format of the alignment xml format of the alignment Second Improved Alignment output.2.dnd file for constructing graphical tree * output.2.fas fasta format of the second alignment output.2.xml xml format of the second alignment * use this file for generating tree image
7 View and Save your alignment using R First install the ape package from the R command prompt: sudo R install.packages("ape") q() #start R from UNIX terminal #only needs to be done once in R #quit R and open gedit library(ape) my_tree < read.tree("output.2.dnd") jpeg("gulo_tree.jpg") plot(my_tree) dev.off() Save these commands to a text file and quit gedit: commands_file.r U N I X R save < commands_file.r eog gulo_tree.jpg #input commands_file.r into R #view image from UNIX command line
8 Using only one Perl script, create a 'pipeline' script to generate a phylogenetic tree of related sequences and save as a jpg image. Pseudocode: 1. use BioPerl to get FASTA formatted sequences * get hominids D-Loop accessions file dloop_accessions.txt * use the dloop_accessions.txt file name as an argument * save sequences to a file in FASTA format: dloop_accessions.fa 2. use PRANK to create an alignment of your sequences from your FASTA file 3. use R to create a phylogenetic tree image of your PRANK alignment * save your image using the file name of your accessions list dloop_accessions.jpg * this means you will need to use Perl to write all the R commands to a file. * hints: Perl Pipeline Script Assignment print R_FILE "jpeg(\"image.jpg\")\n"; #backslash \" to print " `R save < commands_file.r`; #use backticks ` to run a UNIX commands within a Perl script
9 dloop_accessions.list dloop_accessions.jpg AF AF Perl Pipeline Script write BioPerl PRANK a file R dloop_seqs.fa >L-gulono.. CTGTATG TAGACGT output.2.dnd ( A1: , A2: ) commands_file.r library(ape) my_tree <- read attach(my_tree)
Chromatin immunoprecipitation sequencing (ChIP-Seq) on the SOLiD system Nature Methods 6, (2009)
ChIP-seq Chromatin immunoprecipitation (ChIP) is a technique for identifying and characterizing elements in protein-dna interactions involved in gene regulation or chromatin organization. www.illumina.com
More informationAMPHORA2 User Manual. An Automated Phylogenomic Inference Pipeline for Bacterial and Archaeal Sequences. COPYRIGHT 2011 by Martin Wu
AMPHORA2 User Manual An Automated Phylogenomic Inference Pipeline for Bacterial and Archaeal Sequences. COPYRIGHT 2011 by Martin Wu AMPHORA2 is free software: you may redistribute it and/or modify its
More informationSimulation of Molecular Evolution with Bioinformatics Analysis
Simulation of Molecular Evolution with Bioinformatics Analysis Barbara N. Beck, Rochester Community and Technical College, Rochester, MN Project created by: Barbara N. Beck, Ph.D., Rochester Community
More informationSequence Alignment. GBIO0002 Archana Bhardwaj University of Liege
Sequence Alignment GBIO0002 Archana Bhardwaj University of Liege 1 What is Sequence Alignment? A sequence alignment is a way of arranging the sequences of DNA, RNA, or protein to identify regions of similarity.
More informationScientific Programming Practical 10
Scientific Programming Practical 10 Introduction Luca Bianco - Academic Year 2017-18 luca.bianco@fmach.it Biopython FROM Biopython s website: The Biopython Project is an international association of developers
More informationCISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment
CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features
More informationBasic Local Alignment Search Tool (BLAST)
BLAST 26.04.2018 Basic Local Alignment Search Tool (BLAST) BLAST (Altshul-1990) is an heuristic Pairwise Alignment composed by six-steps that search for local similarities. The most used access point to
More informationMetaPhyler Usage Manual
MetaPhyler Usage Manual Bo Liu boliu@umiacs.umd.edu March 13, 2012 Contents 1 What is MetaPhyler 1 2 Installation 1 3 Quick Start 2 3.1 Taxonomic profiling for metagenomic sequences.............. 2 3.2
More informationUsing Linux as a Virtual Machine
Intro to UNIX Using Linux as a Virtual Machine We will use the VMware Player to run a Virtual Machine which is a way of having more than one Operating System (OS) running at once. Your Virtual OS (Linux)
More informationINTRODUCTION TO BIOINFORMATICS
Molecular Biology-2017 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain
More informationLecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:
Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating
More informationSequence Alignment & Search
Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version
More informationPrinciples of Bioinformatics. BIO540/STA569/CSI660 Fall 2010
Principles of Bioinformatics BIO540/STA569/CSI660 Fall 2010 Lecture 11 Multiple Sequence Alignment I Administrivia Administrivia The midterm examination will be Monday, October 18 th, in class. Closed
More informationInstall and run external command line softwares. Yanbin Yin
Install and run external command line softwares Yanbin Yin 1 Create a folder under your home called hw8 Change directory to hw8 Homework #8 Download Escherichia_coli_K_12_substr MG1655_uid57779 faa file
More informationA multiple alignment tool in 3D
Outline Department of Computer Science, Bioinformatics Group University of Leipzig TBI Winterseminar Bled, Slovenia February 2005 Outline Outline 1 Multiple Alignments Problems Goal Outline Outline 1 Multiple
More informationBIOL591: Introduction to Bioinformatics Alignment of pairs of sequences
BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences Reading in text (Mount Bioinformatics): I must confess that the treatment in Mount of sequence alignment does not seem to me a model
More informationProgramming Languages and Uses in Bioinformatics
Programming in Perl Programming Languages and Uses in Bioinformatics Perl, Python Pros: reformatting data files reading, writing and parsing files building web pages and database access building work flow
More informationEnvironmental Sample Classification E.S.C., Josh Katz and Kurt Zimmer
Environmental Sample Classification E.S.C., Josh Katz and Kurt Zimmer Goal: The task we were given for the bioinformatics capstone class was to construct an interface for the Pipas lab that integrated
More informationINTRODUCTION TO BIOINFORMATICS
Molecular Biology-2019 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain
More informationLinux + Galaxy Server Tutorial
Linux + Galaxy Server Tutorial Pei-Chen Peng Linux+Galaxy Pei-Chen Peng 2017 1 Introduction Exercise 1. Download lab data to flash drive. 2. Run a simple bioinformatics program on linux.. 3. Learn Galaxy
More informationGLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment
GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment Scoring Dynamic Programming algorithms Heuristic algorithms CLUSTAL W Courtesy of jalview Motivations Collective (or aggregate) statistic
More informationGrid Computing for Bioinformatics: An Implementation of a User-Friendly Web Portal for ASTI's In Silico Laboratory
Grid Computing for Bioinformatics: An Implementation of a User-Friendly Web Portal for ASTI's In Silico Laboratory R. Babilonia, M. Rey, E. Aldea, U. Sarte gridapps@asti.dost.gov.ph Outline! Introduction:
More informationHORIZONTAL GENE TRANSFER DETECTION
HORIZONTAL GENE TRANSFER DETECTION Sequenzanalyse und Genomik (Modul 10-202-2207) Alejandro Nabor Lozada-Chávez Before start, the user must create a new folder or directory (WORKING DIRECTORY) for all
More informationDynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014
Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into
More informationLab 4: Multiple Sequence Alignment (MSA)
Lab 4: Multiple Sequence Alignment (MSA) The objective of this lab is to become familiar with the features of several multiple alignment and visualization tools, including the data input and output, basic
More informationGenomic Island Hunter (GIHunter)
2013 Genomic Island Hunter (GIHunter) Han Wang, Dongsheng Che Department of Computer Science East Stroudsburg University Contents 1. Requirements 2 2. Installation 3 2.1 Download GIHunter 3 2.2 Extract
More informationMultiple Sequence Alignment Sum-of-Pairs and ClustalW. Ulf Leser
Multiple Sequence Alignment Sum-of-Pairs and ClustalW Ulf Leser This Lecture Multiple Sequence Alignment The problem Theoretical approach: Sum-of-Pairs scores Practical approach: ClustalW Ulf Leser: Bioinformatics,
More informationTutorial 4 BLAST Searching the CHO Genome
Tutorial 4 BLAST Searching the CHO Genome Accessing the CHO Genome BLAST Tool The CHO BLAST server can be accessed by clicking on the BLAST button on the home page or by selecting BLAST from the menu bar
More informationPhylogeny Yun Gyeong, Lee ( )
SpiltsTree Instruction Phylogeny Yun Gyeong, Lee ( ylee307@mail.gatech.edu ) 1. Go to cygwin-x (if you don t have cygwin-x, you can either download it or use X-11 with brand new Mac in 306.) 2. Log in
More informationCS313 Exercise 4 Cover Page Fall 2017
CS313 Exercise 4 Cover Page Fall 2017 Due by the start of class on Thursday, October 12, 2017. Name(s): In the TIME column, please estimate the time you spent on the parts of this exercise. Please try
More informationPyMod 2. User s Guide. PyMod 2 Documention (Last updated: 7/11/2016)
PyMod 2 User s Guide PyMod 2 Documention (Last updated: 7/11/2016) http://schubert.bio.uniroma1.it/pymod/index.html Department of Biochemical Sciences A. Rossi Fanelli, Sapienza University of Rome, Italy
More informationPage 1.1 Guidelines 2 Requirements JCoDA package Input file formats License. 1.2 Java Installation 3-4 Not required in all cases
JCoDA and PGI Tutorial Version 1.0 Date 03/16/2010 Page 1.1 Guidelines 2 Requirements JCoDA package Input file formats License 1.2 Java Installation 3-4 Not required in all cases 2.1 dn/ds calculation
More informationUsing Biopython for Laboratory Analysis Pipelines
Using Biopython for Laboratory Analysis Pipelines Brad Chapman 27 June 2003 What is Biopython? Official blurb The Biopython Project is an international association of developers of freely available Python
More informationGeneious 5.6 Quickstart Manual. Biomatters Ltd
Geneious 5.6 Quickstart Manual Biomatters Ltd October 15, 2012 2 Introduction This quickstart manual will guide you through the features of Geneious 5.6 s interface and help you orient yourself. You should
More informationIn this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace.
5 Multiple Match Refinement and T-Coffee In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace. This exposition
More informationHow to Run NCBI BLAST on zcluster at GACRC
How to Run NCBI BLAST on zcluster at GACRC BLAST: Basic Local Alignment Search Tool Georgia Advanced Computing Resource Center University of Georgia Suchitra Pakala pakala@uga.edu 1 OVERVIEW What is BLAST?
More informationIntroduction to Bioinformatics Software on Bio-Linux
Introduction to Bioinformatics Software on Bio-Linux The aim of this practical is to give you experience with a number of programs using different command line and graphical interfaces. We will begin by
More informationBLAST, Profile, and PSI-BLAST
BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources
More informationPROTEIN MULTIPLE ALIGNMENT MOTIVATION: BACKGROUND: Marina Sirota
Marina Sirota MOTIVATION: PROTEIN MULTIPLE ALIGNMENT To study evolution on the genetic level across a wide range of organisms, biologists need accurate tools for multiple sequence alignment of protein
More informationmpmorfsdb: A database of Molecular Recognition Features (MoRFs) in membrane proteins. Introduction
mpmorfsdb: A database of Molecular Recognition Features (MoRFs) in membrane proteins. Introduction Molecular Recognition Features (MoRFs) are short, intrinsically disordered regions in proteins that undergo
More information1. mirmod (Version: 0.3)
1. mirmod (Version: 0.3) mirmod is a mirna modification prediction tool. It identifies modified mirnas (5' and 3' non-templated nucleotide addition as well as trimming) using small RNA (srna) sequencing
More informationBioinformatics for Biologists
Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover
More informationFASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm.
FASTA INTRODUCTION Definition (by David J. Lipman and William R. Pearson in 1985) - Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence
More informationManaging Your Biological Data with Python
Chapman & Hall/CRC Mathematical and Computational Biology Series Managing Your Biological Data with Python Ailegra Via Kristian Rother Anna Tramontano CRC Press Taylor & Francis Group Boca Raton London
More informationLecture 5 Advanced BLAST
Introduction to Bioinformatics for Medical Research Gideon Greenspan gdg@cs.technion.ac.il Lecture 5 Advanced BLAST BLAST Recap Sequence Alignment Complexity and indexing BLASTN and BLASTP Basic parameters
More informationIntroduction to BLAST with Protein Sequences. Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2
Introduction to BLAST with Protein Sequences Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2 1 References Chapter 2 of Biological Sequence Analysis (Durbin et al., 2001)
More informationIntroduction to Phylogenetics Week 2. Databases and Sequence Formats
Introduction to Phylogenetics Week 2 Databases and Sequence Formats I. Databases Crucial to bioinformatics The bigger the database, the more comparative research data Requires scientists to upload data
More informationMultiple sequence alignment. November 20, 2018
Multiple sequence alignment November 20, 2018 Why do multiple alignment? Gain insight into evolutionary history Can assess time of divergence by looking at the number of mutations needed to change one
More informationIntroduction to UNIX command-line
Introduction to UNIX command-line Boyce Thompson Institute March 17, 2015 Lukas Mueller & Noe Fernandez Class Content Terminal file system navigation Wildcards, shortcuts and special characters File permissions
More informationWorkshop Practical on concatenation and model testing
Workshop Practical on concatenation and model testing Jacob L. Steenwyk & Antonis Rokas Programs that you will use: Bash, Python, Perl, Phyutility, PartitionFinder, awk To infer a putative species phylogeny
More informationAlignMe Manual. Version 1.1. Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest
AlignMe Manual Version 1.1 Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest Max Planck Institute of Biophysics Frankfurt am Main 60438 Germany 1) Introduction...3 2) Using AlignMe
More informationLezione 7. Bioinformatica. Mauro Ceccanti e Alberto Paoluzzi
Lezione 7 Bioinformatica Mauro Ceccanti e Alberto Paoluzzi Dip. Informatica e Automazione Università Roma Tre Dip. Medicina Clinica Università La Sapienza BioPython Installing and exploration Tutorial
More informationPyMod Documentation (Version 2.1, September 2011)
PyMod User s Guide PyMod Documentation (Version 2.1, September 2011) http://schubert.bio.uniroma1.it/pymod/ Emanuele Bramucci & Alessandro Paiardini, Francesco Bossa, Stefano Pascarella, Department of
More informationMUSCLE User Guide. Multiple sequence comparison by log-expectation by Robert C. Edgar. Version 3.0 January 2004
MUSCLE User Guide Multiple sequence comparison by log-expectation by Robert C. Edgar Version 3.0 January 2004 http://www.drive5.com/muscle muscle (at) drive5.com 1 Table of Contents 1 Introduction... 3
More informationLab 8: Using POY from your desktop and through CIPRES
Integrative Biology 200A University of California, Berkeley PRINCIPLES OF PHYLOGENETICS Spring 2012 Updated by Michael Landis Lab 8: Using POY from your desktop and through CIPRES In this lab we re going
More information.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar..
.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. PAM and BLOSUM Matrices Prepared by: Jason Banich and Chris Hoover Background As DNA sequences change and evolve, certain amino acids are more
More informationSequence alignment theory and applications Session 3: BLAST algorithm
Sequence alignment theory and applications Session 3: BLAST algorithm Introduction to Bioinformatics online course : IBT Sonal Henson Learning Objectives Understand the principles of the BLAST algorithm
More informationMultiple Sequence Alignment. Mark Whitsitt - NCSA
Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV
More informationManual of mirdeepfinder for EST or GSS
Manual of mirdeepfinder for EST or GSS Index 1. Description 2. Requirement 2.1 requirement for Windows system 2.1.1 Perl 2.1.2 Install the module DBI 2.1.3 BLAST++ 2.2 Requirement for Linux System 2.2.1
More informationAssignment 6: Motif Finding Bio5488 2/24/17. Slide Credits: Nicole Rockweiler
Assignment 6: Motif Finding Bio5488 2/24/17 Slide Credits: Nicole Rockweiler Assignment 6: Motif finding Input Promoter sequences PWMs of DNA-binding proteins Goal Find putative binding sites in the sequences
More informationFastCluster: a graph theory based algorithm for removing redundant sequences
J. Biomedical Science and Engineering, 2009, 2, 621-625 doi: 10.4236/jbise.2009.28090 Published Online December 2009 (http://www.scirp.org/journal/jbise/). FastCluster: a graph theory based algorithm for
More informationSequence alignment algorithms
Sequence alignment algorithms Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 23 rd 27 After this lecture, you can decide when to use local and global sequence alignments
More informationBIOINFORMATICS A PRACTICAL GUIDE TO THE ANALYSIS OF GENES AND PROTEINS
BIOINFORMATICS A PRACTICAL GUIDE TO THE ANALYSIS OF GENES AND PROTEINS EDITED BY Genome Technology Branch National Human Genome Research Institute National Institutes of Health Bethesda, Maryland B. F.
More informationCOMPARATIVE MICROBIAL GENOMICS ANALYSIS WORKSHOP. Exercise 2: Predicting Protein-encoding Genes, BlastMatrix, BlastAtlas
COMPARATIVE MICROBIAL GENOMICS ANALYSIS WORKSHOP Exercise 2: Predicting Protein-encoding Genes, BlastMatrix, BlastAtlas First of all connect once again to the CBS system: Open ssh shell client. Press Quick
More informationVERY SHORT INTRODUCTION TO UNIX
VERY SHORT INTRODUCTION TO UNIX Tore Samuelsson, Nov 2009. An operating system (OS) is an interface between hardware and user which is responsible for the management and coordination of activities and
More informationCMSC 423 Fall 2009: Project Specification
CMSC 423 Fall 2009: Project Specification Introduction The project will consist of four components due throughout the semester (see below for timeline). Basic rules: You are allowed to work in teams of
More informationComparison and Evaluation of Multiple Sequence Alignment Tools In Bininformatics
IJCSNS International Journal of Computer Science and Network Security, VOL.9 No.7, July 2009 51 Comparison and Evaluation of Multiple Sequence Alignment Tools In Bininformatics Asieh Sedaghatinia, Dr Rodziah
More informationChapter 6. Multiple sequence alignment (week 10)
Course organization Introduction ( Week 1,2) Part I: Algorithms for Sequence Analysis (Week 1-11) Chapter 1-3, Models and theories» Probability theory and Statistics (Week 3)» Algorithm complexity analysis
More informationcgatools Installation Guide
Version 1.3.0 Complete Genomics data is for Research Use Only and not for use in the treatment or diagnosis of any human subject. Information, descriptions and specifications in this publication are subject
More informationSequence Alignment: BLAST
E S S E N T I A L S O F N E X T G E N E R A T I O N S E Q U E N C I N G W O R K S H O P 2015 U N I V E R S I T Y O F K E N T U C K Y A G T C Class 6 Sequence Alignment: BLAST Be able to install and use
More informationEvolutionary Genetics. LV Lecture with exercises 6KP. Bioinformatics. Jean-Claude Walser
Evolutionary Genetics LV 25600-01 Lecture with exercises 6KP Bioinformatics Jean-Claude Walser jean-claude.walser@env.ethz.ch 1 HS2018 What is bioinformatics? Why bioinformatics? What is the difference
More informationCompares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.
Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the
More informationHeuristic methods for pairwise alignment:
Bi03c_1 Unit 03c: Heuristic methods for pairwise alignment: k-tuple-methods k-tuple-methods for alignment of pairs of sequences Bi03c_2 dynamic programming is too slow for large databases Use heuristic
More informationOrthoMCL v1.4. Recall: Web Service: Datadoc v.1 1/29/ Algorithm Description (SCIENCE)
OrthoMCL v1.4 Datadoc v.1 1/29/2007 1. Algorithm Description (SCIENCE) Summary: OrthoMCL is a method that calculates the closest relative to a gene within another species set. For example, protein kinase
More informationQDD For Windows and Linux Version 1 (2009)
QDD For Windows and Linux Version 1 (2009) A user-friendly program to select microsatellite markers and design primers from large sequencing projects Emese Meglécz 1 and Jean-François Martin 2 1 Aix-Marseille
More informationAssessing Transcriptome Assembly
Assessing Transcriptome Assembly Matt Johnson July 9, 2015 1 Introduction Now that you have assembled a transcriptome, you are probably wondering about the sequence content. Are the sequences from the
More informationBioinformatics explained: BLAST. March 8, 2007
Bioinformatics Explained Bioinformatics explained: BLAST March 8, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com Bioinformatics
More informationCAOS Documentation and Worked Examples. Neil Sarkar, Paul Planet and Rob DeSalle
CAOS Documentation and Worked Examples Neil Sarkar, Paul Planet and Rob DeSalle Table of Contents 1. Downloading and Installing p-gnome and p-elf 2. Preparing your matrix for p-gnome 3. Running p-gnome
More informationIntroduction to Bioinformatics Online Course: IBT
Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec2 Choosing the Right Sequences Choosing the Right Sequences Before you build your alignment,
More informationAs of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be
48 Bioinformatics I, WS 09-10, S. Henz (script by D. Huson) November 26, 2009 4 BLAST and BLAT Outline of the chapter: 1. Heuristics for the pairwise local alignment of two sequences 2. BLAST: search and
More informationÜbung: Breakdown of sequence homology
Übung: Breakdown of sequence homology WS 2008/09 Übung zu Anwendungen der Strukturanalyse 4-Feb-09 1. Addresses... 1 2. Gathering sequences... 1 2.1. Collection of your PDB sequence... 1 2.2. Your random
More informationSalvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón
trimal: a tool for automated alignment trimming in large-scale phylogenetics analyses Salvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón Version 1.2b Index of contents 1. General features
More informationSoftware review. Analysis for free: Comparing programs for sequence analysis
Analysis for free: Comparing programs for sequence analysis Keywords: sequence comparison tools, alignment, annotation, freeware, sequence analysis Abstract Programs to import, manage and align sequences
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748
CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/12/07 CAP5510 1 Perl: Practical Extraction & Report Language
More informationBioinformatics explained: Smith-Waterman
Bioinformatics Explained Bioinformatics explained: Smith-Waterman May 1, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com
More informationMultiple Sequence Alignment (MSA)
I519 Introduction to Bioinformatics, Fall 2013 Multiple Sequence Alignment (MSA) Yuzhen Ye (yye@indiana.edu) School of Informatics & Computing, IUB Outline Multiple sequence alignment (MSA) Generalize
More informationUser's guide: Manual for V-Xtractor 2.0
User's guide: Manual for V-Xtractor 2.0 This is a guide to install and use the software utility V-Xtractor. The software is reasonably platform-independent. The instructions below should work fine with
More informationBrief review from last class
Sequence Alignment Brief review from last class DNA is has direction, we will use only one (5 -> 3 ) and generate the opposite strand as needed. DNA is a 3D object (see lecture 1) but we will model it
More informationWeighted Finite-State Transducers in Computational Biology
Weighted Finite-State Transducers in Computational Biology Mehryar Mohri Courant Institute of Mathematical Sciences mohri@cims.nyu.edu Joint work with Corinna Cortes (Google Research). 1 This Tutorial
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 06: Multiple Sequence Alignment https://upload.wikimedia.org/wikipedia/commons/thumb/7/79/rplp0_90_clustalw_aln.gif/575px-rplp0_90_clustalw_aln.gif Slides
More informationR version has been released on (Linux source code versions)
Installation of R and Bioconductor R is a free software environment for statistical computing and graphics. It is based on the statistical computer language S. It is famous for its wide set of statistical
More informationBioinformatics. Computational Methods I: Genomic Resources and Unix. George Bell WIBR Biocomputing Group
Bioinformatics Computational Methods I: Genomic Resources and Unix George Bell WIBR Biocomputing Group Human genome databases Human Genome Sequencing Consortium Major annotators: NCBI Ensembl (EMBL-EBI
More informationBiochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA)
Biochemistry 324 Bioinformatics Multiple Sequence Alignment (MSA) Big- Οh notation Greek omicron symbol Ο The Big-Oh notation indicates the complexity of an algorithm in terms of execution speed and storage
More informationCISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Sequence pairwise alignment Score statistics: E-value and p-value Heuristic algorithms: BLAST and FASTA Database search: gene finding and annotations
More informationGUT. GUT Installation Guide
Date : 02 Feb 2009 1/5 GUT Table of Contents 1 Introduction...2 2 Installing GUT...2 2.1 Optional Extensions...2 2.2 Installing from source...2 2.3 Installing the Linux binary package...4 2.4 Installing
More informationGenome 559: Introduction to Statistical and Computational Genomics. Lecture15a Multiple Sequence Alignment Larry Ruzzo
Genome 559: Introduction to Statistical and Computational Genomics Lecture15a Multiple Sequence Alignment Larry Ruzzo 1 Multiple Alignment: Motivations Common structure, function, or origin may be only
More informationReconstructing long sequences from overlapping sequence fragment. Searching databases for related sequences and subsequences
SEQUENCE ALIGNMENT ALGORITHMS 1 Why compare sequences? Reconstructing long sequences from overlapping sequence fragment Searching databases for related sequences and subsequences Storing, retrieving and
More informationMULTIPLE SEQUENCE ALIGNMENT SOLUTIONS AND APPLICATIONS
MULTIPLE SEQUENCE ALIGNMENT SOLUTIONS AND APPLICATIONS By XU ZHANG A DISSERTATION PRESENTED TO THE GRADUATE SCHOOL OF THE UNIVERSITY OF FLORIDA IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE
More informationHuber & Bulyk, BMC Bioinformatics MS ID , Additional Methods. Installation and Usage of MultiFinder, SequenceExtractor and BlockFilter
Installation and Usage of MultiFinder, SequenceExtractor and BlockFilter I. Introduction: MultiFinder is a tool designed to combine the results of multiple motif finders and analyze the resulting motifs
More information2 Algorithm. Algorithms for CD-HIT were described in three papers published in Bioinformatics.
CD-HIT User s Guide Last updated: 2012-04-25 http://cd-hit.org http://bioinformatics.org/cd-hit/ Program developed by Weizhong Li s lab at UCSD http://weizhong-lab.ucsd.edu liwz@sdsc.edu 1 Contents 2 1
More information