Computational Biology

Size: px
Start display at page:

Download "Computational Biology"

Transcription

1 Compuaional Bioloy A.P. Gulyaev (Saha) Appliaion oriened view appliaion H.J. Hooeboom (Hendrik Jan) Theory oriened view

2 hemes problem model (e. raph) known alorihms haraerizaion unpreise daa omplexiy heurisis wha is he rih answer?

3 enral doma DNA RNA ransripion & spliin proein eiwi ranslaion ene expression

4 wo alphabes DNA bases 4 symbols a RNA a u proeins amino aids 2 symbols A R D N C E Q G H I L K M F P S T W Y V

5 reursion answer quesion

6 reursion: bad example a = a = a n+ = a n +a n (n ) (e.)

7 reursion: dynami prorammin a = a = a n+ = a n +a n (n ),,, 2, 3, 5, 8, 3, 2, dynami prorammin memoizaion sore resuls in able ( work boomup )

8 sruure of RNA sequene sruure funion 2D sruure 3D sruure hp://al.sie.nnu.edu.w/ourse/bioloy/slide_bioloy.pp

9 sequene alinmen TCAGACGATTG TCGGAGCTG inserion deleion subsiuion mah mismah ap TCAGACGATTG TCGGAGCTG TCAGACGATTG TCGGAGCTG TCAGACGATTG TCGGAGCTG

10 sequene alinmen TCAGACGATTG TCGGAGCTG TCAGACGATTG TCGGAGCTG TCAGACGATTG TCGGAGCTG 46=8 23=7 mah mismah ap +2 TCAGACGATTG TCGGAGCTG 44=9

11 basi alorihm alinmen reursive priniple dynami prorammin

12 alinmen: reursion a a a a a a σ(,x) = σ(x,) = σ(x,y) = σ(x,x) = 2 reward and punishmen a a

13 dynami prorammin a a a a * a a

14 dynami prorammin a a a a a a

15 iniializaion a a a

16 dynami prorammin i a[i,j] = max a j a a[i,j] + a[i,j] + σ( s[i],[j] ) a[i,j] + a a a a +2 a a a a

17 alinmen a a a a

18 raebak a a a a a a a a a a

19 /* Reursion: he hear of he DP alorihm.*/ /* Iniializaion. */ S[][] = ; for (i = ; i <= M; i++) S[i][] = i * INDEL; for (j = ; j <= N; j++) S[][j] = j * INDEL; Eddy S.R. (24a) /* Dynami prorammin, lobal alinmen (Needleman/Wunsh) reursion. */ for (i = ; i <= M; i++) for (j = ; j <= N; j++) { /* ase #: i,j are alined */ if (x[i x[i] == y[j]) S[i][j] ] = S[i][j ][j] + MATCH; else S[i][j] ] = S[i][j ][j] + MISMATCH; s = S[i][j] + INDEL; /* ase #2: i alined o */ if (s > S[i][j]) ]) S[i][j] ] = s; } s = S[i][j] + INDEL; /* ase #3: j alined o */ if (s > S[i][j]) ]) S[i][j] ] = s; /* The resul (opimal alinmen sore) is now in S[M][N]. */

20 sorin and parameer hoie A A A C AT TA vs. vs. vs. A C A C AT TA mah mismah ap M m A C G T A C 25 3 G 4 T 9 ap 4 + 3k ask your favourie moleular biolois!

21 PAM25 Marix deails noes APG biohemial properies muaion prob (evoluion)

22 alinmen CAGCACTTGGATTCTCGG CAGCGTGG CAGCACTTGGATTCTCGG CAGCGTGG

23 varians of alinmen > lobal Needleman & Wunsh loal Smih & Waerman semilobal end

24 loal alinmen a[i,j] = max a[i,j] + a[i,j] + σ( s[i],[j] ) a[i,j] + max soluion (raebak) from max o

25 loal alinmen max

26 end alinmen s iniial ap ssssssssssss max final ap iniializaion wih zero s max on border(s)

27 savin spae O(mn) boh spae & ime Hirshber: linear spae j [ i] [ j] [i m] [j n] i T(m,n) 2mn T(m,n) mn/2 + mn/2 + T(i,n/2)+T(ni,n/2) mn + in + (mi)n = 2mn

28 savin spae O(mn) boh spae & ime Hirshber: linear spae j [ i] [ j] [i m] [j n] i +/2+/4+ = 2

29 eneral ap penalies (k) = k (k) = +ke (k) ap penaly open ap, exend ap arbirary os sandard eneral affine ap lenh

30 a a dynami prorammin b wih hree maries a a a a a a a a a a a a a a a a a a b

31 affine ap penalies dynami prorammin wih hree maries (k) = +ke open ap, exend ap b[i,j]= max a[i,j] e b[i,j] e [i,j] e ap was already open j a a a a i a a b O(mn ) vs. O(mn 2 + m 2 n ) eneral ap penaly

32 omparin similar sequenes O(mn) quadrai boh spae & ime redue ime k depends on number of dashes k banded alinmen linear ime heurisi se k based on upper bound for alinmen exa while improvemen do k = 2k

33 alinin several sequenes aidi ribosomal proein P homolo (LE) enoded by he Rplp ene

34 omparin muliple sequenes how o sore? SP sumofpairs pairs of symbols pairs of srins deails noes APG A C T G G G A A T G C G A A C T C C C dynami prorammin possible bu oo muh spae & ime heurisi redue searh spae (banded alinmen) problem is NPomplee (# srins = dimension!) heurisi sar alinmen / proressive alinmen hidden Markov model

35 sar alinmen srin in ener (whih one?) ompue pairwise alinmens exend pairs ino muliple alinmen one a ap, always a ap O(k 2 m 2 ) k sequenes, m lenh heory: wihin faor 2 of opimal alinmen

36 sar alinmen ATTGCCATT 2 ATGGCCATT 3 ATCCAATTTT 4 ATCTTCTT 5 ACTGACC ATTGCCATT 2 ATGGCCATT ATTGCCATT 3 ATCCAATTTT ATTGCCATT 4 ATCTTCTT ATTGCCATT 5 ACTGACC ATTGCCATT 2 ATGGCCATT 3 ATCCAATTTT ATTGCCATT 2 ATGGCCATT 3 ATCCAATTTT 4 ATCTTCTT 5 ACTGACC

37 uide ree boomup sequenes in leaves proressive alinmen ree known evoluionary relaion build ree luserin alo s ClusalW inner nodes ombine alinmens (profiles varian basi alo)

38 probleem solved!? muh oo slow lon srins hue daabases heurisis FASTA alon diaonal BLAST minimal lose mah muliple alinmen (several srins) NP omplee exponenial

39 human enome saisis 23 pairs of hromosomes 3. 9 nuleoide bases avarae 3 bases / ene dysrophin 2.4 million 3, 4, enes proein varians million (spliin) 99.9% exaly he same in humans

40 Basi Loal Alinmen Searh Tools query query word (W=3) GSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNL neihbourhood words hreshold PQG 8 PEG 5 PRG 4 PMG 3 PQA 2 PQN 2 SLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNL TLASVLDCTVTPMGSRMLKRWLHMPVRDTRVLLERQQT subje hihsorin semen pair (HSP) parameers: W word size T hreshold S sore E expeed

Computational Biology 6.095/6.895 Database Search Lecture 5 Prof. Piotr Indyk

Computational Biology 6.095/6.895 Database Search Lecture 5 Prof. Piotr Indyk Computational Biology 6.095/6.895 Database Searh Leture 5 Prof. Piotr Indyk Previous letures Leture -3: Global alignment in O(mn) Dynami programming Leture -2: Loal alignment, variants, in O(mn) Leture

More information

Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University

Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University 1 Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment 2 The number of all possible pairwise alignments (if gaps are allowed)

More information

Using CANopen Slave Driver

Using CANopen Slave Driver CAN Bus User Manual Using CANopen Slave Driver V1. Table of Conens 1. SDO Communicaion... 1 2. PDO Communicaion... 1 3. TPDO Reading and RPDO Wriing... 2 4. RPDO Reading... 3 5. CANopen Communicaion Parameer

More information

Sam knows that his MP3 player has 40% of its battery life left and that the battery charges by an additional 12 percentage points every 15 minutes.

Sam knows that his MP3 player has 40% of its battery life left and that the battery charges by an additional 12 percentage points every 15 minutes. 8.F Baery Charging Task Sam wans o ake his MP3 player and his video game player on a car rip. An hour before hey plan o leave, he realized ha he forgo o charge he baeries las nigh. A ha poin, he plugged

More information

Pairwise Sequence Alignment: Dynamic Programming Algorithms. COMP Spring 2015 Luay Nakhleh, Rice University

Pairwise Sequence Alignment: Dynamic Programming Algorithms. COMP Spring 2015 Luay Nakhleh, Rice University Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 - Spring 2015 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment The number of all possible pairwise alignments (if

More information

Reconstructing long sequences from overlapping sequence fragment. Searching databases for related sequences and subsequences

Reconstructing long sequences from overlapping sequence fragment. Searching databases for related sequences and subsequences SEQUENCE ALIGNMENT ALGORITHMS 1 Why compare sequences? Reconstructing long sequences from overlapping sequence fragment Searching databases for related sequences and subsequences Storing, retrieving and

More information

Gauss-Jordan Algorithm

Gauss-Jordan Algorithm Gauss-Jordan Algorihm The Gauss-Jordan algorihm is a sep by sep procedure for solving a sysem of linear equaions which may conain any number of variables and any number of equaions. The algorihm is carried

More information

Data Structures and Algorithms. The material for this lecture is drawn, in part, from The Practice of Programming (Kernighan & Pike) Chapter 2

Data Structures and Algorithms. The material for this lecture is drawn, in part, from The Practice of Programming (Kernighan & Pike) Chapter 2 Daa Srucures and Algorihms The maerial for his lecure is drawn, in par, from The Pracice of Programming (Kernighan & Pike) Chaper 2 1 Moivaing Quoaion Every program depends on algorihms and daa srucures,

More information

Optimal Crane Scheduling

Optimal Crane Scheduling Opimal Crane Scheduling Samid Hoda, John Hooker Laife Genc Kaya, Ben Peerson Carnegie Mellon Universiy Iiro Harjunkoski ABB Corporae Research EWO - 13 November 2007 1/16 Problem Track-mouned cranes move

More information

Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD

Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Assumptions: Biological sequences evolved by evolution. Micro scale changes: For short sequences (e.g. one

More information

Data Structures and Algorithms

Data Structures and Algorithms Daa Srucures and Algorihms The maerial for his lecure is drawn, in ar, from The Pracice of Programming (Kernighan & Pike) Chaer 2 1 Goals of his Lecure Hel you learn (or refresh your memory) abou: Common

More information

Bioinformatics for Biologists

Bioinformatics for Biologists Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover

More information

The Advice Complexity of a Class of Hard Online Problems

The Advice Complexity of a Class of Hard Online Problems The Advie Complexiy of a Class of Hard Online Problems Joan Boyar, Lene M. Favrhold, Chrisian Kudahl, and Jesper W. Mikkelsen Deparmen of Mahemais and Compuer Siene Universiy of Souhern Denmark July 1,

More information

CAMERA CALIBRATION BY REGISTRATION STEREO RECONSTRUCTION TO 3D MODEL

CAMERA CALIBRATION BY REGISTRATION STEREO RECONSTRUCTION TO 3D MODEL CAMERA CALIBRATION BY REGISTRATION STEREO RECONSTRUCTION TO 3D MODEL Klečka Jan Docoral Degree Programme (1), FEEC BUT E-mail: xkleck01@sud.feec.vubr.cz Supervised by: Horák Karel E-mail: horak@feec.vubr.cz

More information

Computational Molecular Biology

Computational Molecular Biology Computational Molecular Biology Erwin M. Bakker Lecture 2 Materials used from R. Shamir [2] and H.J. Hoogeboom [4]. 1 Molecular Biology Sequences DNA A, T, C, G RNA A, U, C, G Protein A, R, D, N, C E,

More information

Elastic web processing lines : optimal tension and velocity closed loop bandwidths

Elastic web processing lines : optimal tension and velocity closed loop bandwidths Elasi web proessing lines : opimal ension and veloiy losed loop bandwidhs Dominique KNIEL, Prof Web Handling Researh Group, Universiy of Srasbourg, Frane kniel@unisra.fr 6 AIMCAL Web Coaing & Handling

More information

Chapter 4: Blast. Chaochun Wei Fall 2014

Chapter 4: Blast. Chaochun Wei Fall 2014 Course organization Introduction ( Week 1-2) Course introduction A brief introduction to molecular biology A brief introduction to sequence comparison Part I: Algorithms for Sequence Analysis (Week 3-11)

More information

Real Time Integral-Based Structural Health Monitoring

Real Time Integral-Based Structural Health Monitoring Real Time Inegral-Based Srucural Healh Monioring The nd Inernaional Conference on Sensing Technology ICST 7 J. G. Chase, I. Singh-Leve, C. E. Hann, X. Chen Deparmen of Mechanical Engineering, Universiy

More information

Multiple Sequence Alignment

Multiple Sequence Alignment . Multiple Sequence lignment utorial #4 Ilan ronau Multiple Sequence lignment Reminder S = S = S = Possible alignment Possible alignment Multiple Sequence lignment Reminder Input: Sequences S, S,, S over

More information

Quantitative macro models feature an infinite number of periods A more realistic (?) view of time

Quantitative macro models feature an infinite number of periods A more realistic (?) view of time INFINIE-HORIZON CONSUMPION-SAVINGS MODEL SEPEMBER, Inroducion BASICS Quaniaive macro models feaure an infinie number of periods A more realisic (?) view of ime Infinie number of periods A meaphor for many

More information

4. Minimax and planning problems

4. Minimax and planning problems CS/ECE/ISyE 524 Inroducion o Opimizaion Spring 2017 18 4. Minima and planning problems ˆ Opimizing piecewise linear funcions ˆ Minima problems ˆ Eample: Chebyshev cener ˆ Muli-period planning problems

More information

Today. Quiz Introduction to pipelining

Today. Quiz Introduction to pipelining Pipelining 1 Tody Quiz Inroduion o pipelining 2 Pipelining 10ns (10ns) 20ns (10ns) 30ns (10ns) Wh s he leny for one uni of work? Wh s he hroughpu? Pipelining 1.Brek up he logi wih lhes ino pipeline sges

More information

Assignment 2. Due Monday Feb. 12, 10:00pm.

Assignment 2. Due Monday Feb. 12, 10:00pm. Faculy of rs and Science Universiy of Torono CSC 358 - Inroducion o Compuer Neworks, Winer 218, LEC11 ssignmen 2 Due Monday Feb. 12, 1:pm. 1 Quesion 1 (2 Poins): Go-ack n RQ In his quesion, we review how

More information

EECS 487: Interactive Computer Graphics

EECS 487: Interactive Computer Graphics EECS 487: Ineracive Compuer Graphics Lecure 7: B-splines curves Raional Bézier and NURBS Cubic Splines A represenaion of cubic spline consiss of: four conrol poins (why four?) hese are compleely user specified

More information

BI-TEMPORAL INDEXING

BI-TEMPORAL INDEXING BI-TEMPORAL INDEXING Mirella M. Moro Uniersidade Federal do Rio Grande do Sul Poro Alegre, RS, Brazil hp://www.inf.ufrgs.br/~mirella/ Vassilis J. Tsoras Uniersiy of California, Rierside Rierside, CA 92521,

More information

COMP26120: Algorithms and Imperative Programming

COMP26120: Algorithms and Imperative Programming COMP26120 ecure C3 1/48 COMP26120: Algorihms and Imperaive Programming ecure C3: C - Recursive Daa Srucures Pee Jinks School of Compuer Science, Universiy of Mancheser Auumn 2011 COMP26120 ecure C3 2/48

More information

1 œ DRUM SET KEY. 8 Odd Meter Clave Conor Guilfoyle. Cowbell (neck) Cymbal. Hi-hat. Floor tom (shell) Clave block. Cowbell (mouth) Hi tom.

1 œ DRUM SET KEY. 8 Odd Meter Clave Conor Guilfoyle. Cowbell (neck) Cymbal. Hi-hat. Floor tom (shell) Clave block. Cowbell (mouth) Hi tom. DRUM SET KEY Hi-ha Cmbal Clave block Cowbell (mouh) 0 Cowbell (neck) Floor om (shell) Hi om Mid om Snare Floor om Snare cross sick or clave block Bass drum Hi-ha wih foo 8 Odd Meer Clave Conor Guilfole

More information

Ugail H (2007): "3D Data Modelling and Processing using Partial Differential Equations", Advances and Applications of Dezert-Smarandache Theory for

Ugail H (2007): 3D Data Modelling and Processing using Partial Differential Equations, Advances and Applications of Dezert-Smarandache Theory for Ugail H (7): "3D Daa Modelling and Proessing using Parial Differenial Equaions", Advanes and Appliaions of Dezer-Smarandahe Theory for Plausible and Paradoxial Reasoning for Informaion Fusion, Bulgarian

More information

Local Alignment & Gap Penalties CMSC 423

Local Alignment & Gap Penalties CMSC 423 Local Alignment & ap Penalties CMSC 423 lobal, Semi-global, Local Alignments Last time, we saw a dynamic programming algorithm for global alignment: both strings s and t must be completely matched: s t

More information

CENG 477 Introduction to Computer Graphics. Modeling Transformations

CENG 477 Introduction to Computer Graphics. Modeling Transformations CENG 477 Inroducion o Compuer Graphics Modeling Transformaions Modeling Transformaions Model coordinaes o World coordinaes: Model coordinaes: All shapes wih heir local coordinaes and sies. world World

More information

PART 1 REFERENCE INFORMATION CONTROL DATA 6400 SYSTEMS CENTRAL PROCESSOR MONITOR

PART 1 REFERENCE INFORMATION CONTROL DATA 6400 SYSTEMS CENTRAL PROCESSOR MONITOR . ~ PART 1 c 0 \,).,,.,, REFERENCE NFORMATON CONTROL DATA 6400 SYSTEMS CENTRAL PROCESSOR MONTOR n CONTROL DATA 6400 Compuer Sysems, sysem funcions are normally handled by he Monior locaed in a Peripheral

More information

NEWTON S SECOND LAW OF MOTION

NEWTON S SECOND LAW OF MOTION Course and Secion Dae Names NEWTON S SECOND LAW OF MOTION The acceleraion of an objec is defined as he rae of change of elociy. If he elociy changes by an amoun in a ime, hen he aerage acceleraion during

More information

From [4] D. Gusfield. Algorithms on Strings, Trees and Sequences. Cambridge University Press, New York, 1997.

From [4] D. Gusfield. Algorithms on Strings, Trees and Sequences. Cambridge University Press, New York, 1997. Multiple Alignment From [4] D. Gusfield. Algorithms on Strings, Trees and Sequences. Cambridge University Press, New York, 1997. 1 Multiple Sequence Alignment Introduction Very active research area Very

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 04: Variations of sequence alignments http://www.pitt.edu/~mcs2/teaching/biocomp/tutorials/global.html Slides adapted from Dr. Shaojie Zhang (University

More information

CS 152 Computer Architecture and Engineering. Lecture 7 - Memory Hierarchy-II

CS 152 Computer Architecture and Engineering. Lecture 7 - Memory Hierarchy-II CS 152 Compuer Archiecure and Engineering Lecure 7 - Memory Hierarchy-II Krse Asanovic Elecrical Engineering and Compuer Sciences Universiy of California a Berkeley hp://www.eecs.berkeley.edu/~krse hp://ins.eecs.berkeley.edu/~cs152

More information

Piecewise Linear Models

Piecewise Linear Models 6-6 Applied Operaions Research Piecewise Linear Models Deparmen of Mahemaics and Saisics The Universi of Melbourne This presenaion has been made in accordance wih he provisions of Par VB of he coprigh

More information

Sequence Alignment. COMPSCI 260 Spring 2016

Sequence Alignment. COMPSCI 260 Spring 2016 Sequence Alignment COMPSCI 260 Spring 2016 Why do we want to compare DNA or protein sequences? Find genes similar to known genes IdenGfy important (funcgonal) sequences by finding conserved regions As

More information

Dynamic Programming (cont d) CS 466 Saurabh Sinha

Dynamic Programming (cont d) CS 466 Saurabh Sinha Dynamic Programming (cont d) CS 466 Saurabh Sinha Spliced Alignment Begins by selecting either all putative exons between potential acceptor and donor sites or by finding all substrings similar to the

More information

Computational Molecular Biology

Computational Molecular Biology Computational Molecular Biology Erwin M. Bakker Lecture 3, mainly from material by R. Shamir [2] and H.J. Hoogeboom [4]. 1 Pairwise Sequence Alignment Biological Motivation Algorithmic Aspect Recursive

More information

MARSS Reference Sheet

MARSS Reference Sheet MARSS Reference Shee The defaul MARSS model (form="marxss") is wrien as follows: x = B x 1 + u + C c + w where w MVN( Q ) y = Z x + a + D d + v where v MVN( R ) x 1 MVN(π Λ) or x MVN(π Λ) c and d are inpus

More information

Ray Casting. Outline. Outline in Code

Ray Casting. Outline. Outline in Code Foundaions of ompuer Graphics Online Lecure 10: Ray Tracing 2 Nus and ols amera Ray asing Ravi Ramamoorhi Ouline amera Ray asing (choose ray direcions) Ray-objec inersecions Ray-racing ransformed objecs

More information

Biology 644: Bioinformatics

Biology 644: Bioinformatics Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find

More information

A Hybrid Genetic Algorithm-Simulated Annealing for Integrated Production-Distribution Scheduling in Supply Chain Management

A Hybrid Genetic Algorithm-Simulated Annealing for Integrated Production-Distribution Scheduling in Supply Chain Management Engineering Mahemais 2017; 2(1): 31-40 hp://www.sienepublishinggroup.om//engmah doi: 10.11648/.engmah.20170201.15 A Hybrid Genei Algorihm-Simulaed Annealing for Inegraed Produion-Disribuion Sheduling in

More information

MATH Differential Equations September 15, 2008 Project 1, Fall 2008 Due: September 24, 2008

MATH Differential Equations September 15, 2008 Project 1, Fall 2008 Due: September 24, 2008 MATH 5 - Differenial Equaions Sepember 15, 8 Projec 1, Fall 8 Due: Sepember 4, 8 Lab 1.3 - Logisics Populaion Models wih Harvesing For his projec we consider lab 1.3 of Differenial Equaions pages 146 o

More information

An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST

An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise

More information

Implementing Ray Casting in Tetrahedral Meshes with Programmable Graphics Hardware (Technical Report)

Implementing Ray Casting in Tetrahedral Meshes with Programmable Graphics Hardware (Technical Report) Implemening Ray Casing in Terahedral Meshes wih Programmable Graphics Hardware (Technical Repor) Marin Kraus, Thomas Erl March 28, 2002 1 Inroducion Alhough cell-projecion, e.g., [3, 2], and resampling,

More information

As of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be

As of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be 48 Bioinformatics I, WS 09-10, S. Henz (script by D. Huson) November 26, 2009 4 BLAST and BLAT Outline of the chapter: 1. Heuristics for the pairwise local alignment of two sequences 2. BLAST: search and

More information

Ray Tracing II. Improving Raytracing Speed. Improving Computational Complexity. Raytracing Computational Complexity

Ray Tracing II. Improving Raytracing Speed. Improving Computational Complexity. Raytracing Computational Complexity Ra Tracing II Iproving Raracing Speed Copuer Graphics Ra Tracing II 2005 Fabio Pellacini 1 Copuer Graphics Ra Tracing II 2005 Fabio Pellacini 2 Raracing Copuaional Coplei ra-scene inersecion is epensive

More information

Lecture 18: Mix net Voting Systems

Lecture 18: Mix net Voting Systems 6.897: Advanced Topics in Crypography Apr 9, 2004 Lecure 18: Mix ne Voing Sysems Scribed by: Yael Tauman Kalai 1 Inroducion In he previous lecure, we defined he noion of an elecronic voing sysem, and specified

More information

UML in Action. A Two-Layered Interpretation for Testing. Bernhard K. Aichernig Joint work with Harald Brandl, Elisabeth Jöbstl, Willibald Krenn

UML in Action. A Two-Layered Interpretation for Testing. Bernhard K. Aichernig Joint work with Harald Brandl, Elisabeth Jöbstl, Willibald Krenn Insiue for Sofware Technology A Two-Layered Inerpreaion for Tesing Bernhard K. Aichernig Join work wih Harald Brandl, Elisabeh Jöbsl, Willibald Krenn Insiue for Sofware Technology Graz Universiy of Technology

More information

Automatic 3D Facial Expression Editing in Videos

Automatic 3D Facial Expression Editing in Videos Auomai 3D Faial Expression Ediing in Videos Ya Chang, Marelo Vieira 2, Mahew Turk, Luiz Velho 2 Universiy of California, ana Barbara 2 IMPA Insiuo de Maemaia Pura e Apliada Absra In his paper, we inrodue

More information

STEREO PLANE MATCHING TECHNIQUE

STEREO PLANE MATCHING TECHNIQUE STEREO PLANE MATCHING TECHNIQUE Commission III KEY WORDS: Sereo Maching, Surface Modeling, Projecive Transformaion, Homography ABSTRACT: This paper presens a new ype of sereo maching algorihm called Sereo

More information

CMPSC 274: Transac0on Processing Lecture #6: Concurrency Control Protocols

CMPSC 274: Transac0on Processing Lecture #6: Concurrency Control Protocols CMPSC 274: Transac0on Processing Lecure #6: Concurrency Conrol Proocols Divy Agrawal Deparmen of Compuer Science UC Sana Barbara 4.4.1 Timesamp Ordering 4.4.2 Serializa0on Graph Tes0ng 4.4.3 Op0mis0c Proocols

More information

Lecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:

Lecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations: Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating

More information

Image Content Representation

Image Content Representation Image Conen Represenaion Represenaion for curves and shapes regions relaionships beween regions E.G.M. Perakis Image Represenaion & Recogniion 1 Reliable Represenaion Uniqueness: mus uniquely specify an

More information

Adding Time to an Object-Oriented Versions Model

Adding Time to an Object-Oriented Versions Model Insiuo de Informáica Universidade Federal do Rio Grande do Sul Poro Alegre - RS - BRAZIL Adding Time o an Objec-Oriened Versions Model Mirella Moura Moro Nina Edelweiss Silvia Maria Saggiorao Clesio Saraiva

More information

Sequence Alignment & Search

Sequence Alignment & Search Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version

More information

24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:

24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading: 24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid

More information

Image segmentation. Motivation. Objective. Definitions. A classification of segmentation techniques. Assumptions for thresholding

Image segmentation. Motivation. Objective. Definitions. A classification of segmentation techniques. Assumptions for thresholding Moivaion Image segmenaion Which pixels belong o he same objec in an image/video sequence? (spaial segmenaion) Which frames belong o he same video sho? (emporal segmenaion) Which frames belong o he same

More information

Hidden Markov Model and Chapman Kolmogrov for Protein Structures Prediction from Images

Hidden Markov Model and Chapman Kolmogrov for Protein Structures Prediction from Images Hidden Markov Model and Chapman Kolmogrov for Proein Srucures Predicion from Images Md.Sarwar Kamal 1, Linkon Chowdhury 2, Mohammad Ibrahim Khan 2, Amira S. Ashour 3, João Manuel R.S. Tavares 4, Nilanjan

More information

CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment

CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features

More information

It is easier to visualize plotting the curves of cos x and e x separately: > plot({cos(x),exp(x)},x = -5*Pi..Pi,y = );

It is easier to visualize plotting the curves of cos x and e x separately: > plot({cos(x),exp(x)},x = -5*Pi..Pi,y = ); Mah 467 Homework Se : some soluions > wih(deools): wih(plos): Warning, he name changecoords has been redefined Problem :..7 Find he fixed poins, deermine heir sabiliy, for x( ) = cos x e x > plo(cos(x)

More information

Effects needed for Realism. Ray Tracing. Ray Tracing: History. Outline. Foundations of Computer Graphics (Fall 2012)

Effects needed for Realism. Ray Tracing. Ray Tracing: History. Outline. Foundations of Computer Graphics (Fall 2012) Foundaions of ompuer Graphics (Fall 2012) S 184, Lecure 16: Ray Tracing hp://ins.eecs.berkeley.edu/~cs184 Effecs needed for Realism (Sof) Shadows Reflecions (Mirrors and Glossy) Transparency (Waer, Glass)

More information

TCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology?

TCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology? Local Sequence Alignment & Heuristic Local Aligners Lectures 18 Nov 28, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall

More information

Mouse, Human, Chimpanzee

Mouse, Human, Chimpanzee More Alignments 1 Mouse, Human, Chimpanzee Mouse to Human Chimpanzee to Human 2 Mouse v.s. Human Chromosome X of Mouse to Human 3 Local Alignment Given: two sequences S and T Find: substrings of S and

More information

Heuristic methods for pairwise alignment:

Heuristic methods for pairwise alignment: Bi03c_1 Unit 03c: Heuristic methods for pairwise alignment: k-tuple-methods k-tuple-methods for alignment of pairs of sequences Bi03c_2 dynamic programming is too slow for large databases Use heuristic

More information

1.4 Application Separable Equations and the Logistic Equation

1.4 Application Separable Equations and the Logistic Equation 1.4 Applicaion Separable Equaions and he Logisic Equaion If a separable differenial equaion is wrien in he form f ( y) dy= g( x) dx, hen is general soluion can be wrien in he form f ( y ) dy = g ( x )

More information

Outline. Sequence Alignment. Types of Sequence Alignment. Genomics & Computational Biology. Section 2. How Computers Store Information

Outline. Sequence Alignment. Types of Sequence Alignment. Genomics & Computational Biology. Section 2. How Computers Store Information enomics & omputational Biology Section Lan Zhang Sep. th, Outline How omputers Store Information Sequence lignment Dot Matrix nalysis Dynamic programming lobal: NeedlemanWunsch lgorithm Local: SmithWaterman

More information

Dynamic Programming part 2

Dynamic Programming part 2 Dynamic Programming part 2 Week 7 Objectives More dynamic programming examples - Matrix Multiplication Parenthesis - Longest Common Subsequence Subproblem Optimal structure Defining the dynamic recurrence

More information

TUTORING TEXTS IN MATHCAD

TUTORING TEXTS IN MATHCAD TUTORING TEXTS IN MATHCAD MIROSLAV DOLOZÍILEK and ANNA RYNDOVÁ Faculy of Mechanical Engineering, Brno Universiy of Technology Technická, 616 69 Brno, Czech Republic E-ail: irdo@fyzika.fe.vubr.cz Absrac

More information

Evaluation and Improvement of Region-based Motion Segmentation

Evaluation and Improvement of Region-based Motion Segmentation Evaluaion and Improvemen of Region-based Moion Segmenaion Mark Ross Universiy Koblenz-Landau, Insiue of Compuaional Visualisics, Universiässraße 1, 56070 Koblenz, Germany Email: ross@uni-koblenz.de Absrac

More information

Multiple Alignment. From [4] D. Gusfield. Algorithms on Strings, Trees and Sequences. Cambridge University Press, New York, 1997.

Multiple Alignment. From [4] D. Gusfield. Algorithms on Strings, Trees and Sequences. Cambridge University Press, New York, 1997. Multiple Alignment From [4] D. Gusfield. Algorithms on Strings, Trees and Sequences. Cambridge University Press, New York, 1997. 1 Multiple Sequence Alignment Introduction Very active research area Very

More information

Dynamic Programming. Lecture #8 of Algorithms, Data structures and Complexity. Joost-Pieter Katoen Formal Methods and Tools Group

Dynamic Programming. Lecture #8 of Algorithms, Data structures and Complexity. Joost-Pieter Katoen Formal Methods and Tools Group Dynami Programming Leture #8 of Algorithms, Data strutures and Complexity Joost-Pieter Katoen Formal Methods and Tools Group E-mail: katoen@s.utwente.nl Otober 29, 2002 JPK #8: Dynami Programming ADC (214020)

More information

Representing Non-Manifold Shapes in Arbitrary Dimensions

Representing Non-Manifold Shapes in Arbitrary Dimensions Represening Non-Manifold Shapes in Arbirary Dimensions Leila De Floriani,2 and Annie Hui 2 DISI, Universiy of Genova, Via Dodecaneso, 35-646 Genova (Ialy). 2 Deparmen of Compuer Science, Universiy of Maryland,

More information

FastA & the chaining problem

FastA & the chaining problem FastA & the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 1 Sources for this lecture: Lectures by Volker Heun, Daniel Huson and Knut Reinert,

More information

ME 406 Assignment #1 Solutions

ME 406 Assignment #1 Solutions Assignmen#1Sol.nb 1 ME 406 Assignmen #1 Soluions PROBLEM 1 We define he funcion for Mahemaica. In[1]:= f@_d := Ep@D - 4 Sin@D (a) We use Plo o consruc he plo. In[2]:= Plo@f@D, 8, -5, 5

More information

Gaps ATTACGTACTCCATG ATTACGT CATG. In an edit script we need 4 edit operations for the gap of length 4.

Gaps ATTACGTACTCCATG ATTACGT CATG. In an edit script we need 4 edit operations for the gap of length 4. Gaps ATTACGTACTCCATG ATTACGT CATG In an edit script we need 4 edit operations for the gap of length 4. In maximal score alignments we treat the dash " " like any other character, hence we charge the s(x,

More information

Nonparametric CUSUM Charts for Process Variability

Nonparametric CUSUM Charts for Process Variability Journal of Academia and Indusrial Research (JAIR) Volume 3, Issue June 4 53 REEARCH ARTICLE IN: 78-53 Nonparameric CUUM Chars for Process Variabiliy D.M. Zombade and V.B. Ghue * Dep. of aisics, Walchand

More information

FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:

FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10: FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:56 4001 4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem

More information

MOBILE COMPUTING. Wi-Fi 9/20/15. CSE 40814/60814 Fall Wi-Fi:

MOBILE COMPUTING. Wi-Fi 9/20/15. CSE 40814/60814 Fall Wi-Fi: MOBILE COMPUTING CSE 40814/60814 Fall 2015 Wi-Fi Wi-Fi: name is NOT an abbreviaion play on Hi-Fi (high fideliy) Wireless Local Area Nework (WLAN) echnology WLAN and Wi-Fi ofen used synonymous Typically

More information

MOBILE COMPUTING 3/18/18. Wi-Fi IEEE. CSE 40814/60814 Spring 2018

MOBILE COMPUTING 3/18/18. Wi-Fi IEEE. CSE 40814/60814 Spring 2018 MOBILE COMPUTING CSE 40814/60814 Spring 2018 Wi-Fi Wi-Fi: name is NOT an abbreviaion play on Hi-Fi (high fideliy) Wireless Local Area Nework (WLAN) echnology WLAN and Wi-Fi ofen used synonymous Typically

More information

A non-stationary uniform tension controlled interpolating 4-point scheme reproducing conics

A non-stationary uniform tension controlled interpolating 4-point scheme reproducing conics A non-saionary uniform ension conrolled inerpolaing 4-poin scheme reproducing conics C. Beccari a, G. Casciola b, L. Romani b, a Deparmen of Pure and Applied Mahemaics, Universiy of Padova, Via G. Belzoni

More information

Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion.

Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. www.ijarcet.org 54 Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. Hassan Kehinde Bello and Kazeem Alagbe Gbolagade Abstract Biological sequence alignment is becoming popular

More information

REDUCTIONS BBM ALGORITHMS DEPT. OF COMPUTER ENGINEERING ERKUT ERDEM. Bird s-eye view. May. 12, Reduction.

REDUCTIONS BBM ALGORITHMS DEPT. OF COMPUTER ENGINEERING ERKUT ERDEM. Bird s-eye view. May. 12, Reduction. BBM 0 - ALGORITHMS DEPT. OF COMPUTER ENGINEERING ERKUT ERDEM REDUCTIONS May., 0 Bird s-eye view Desideraa. Classify problems according o compuaional requiremens. complexiy order of growh examples linear

More information

Shortest Path Algorithms. Lecture I: Shortest Path Algorithms. Example. Graphs and Matrices. Setting: Dr Kieran T. Herley.

Shortest Path Algorithms. Lecture I: Shortest Path Algorithms. Example. Graphs and Matrices. Setting: Dr Kieran T. Herley. Shores Pah Algorihms Background Seing: Lecure I: Shores Pah Algorihms Dr Kieran T. Herle Deparmen of Compuer Science Universi College Cork Ocober 201 direced graph, real edge weighs Le he lengh of a pah

More information

Sequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC--

Sequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC-- Sequence Alignment Sequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC-- TAG-CTATCAC--GACCGC--GGTCGATTTGCCCGAC Distance from sequences

More information

Bioinformatics. Sequence alignment BLAST Significance. Next time Protein Structure

Bioinformatics. Sequence alignment BLAST Significance. Next time Protein Structure Bioinformatics Sequence alignment BLAST Significance Next time Protein Structure 1 Experimental origins of sequence data The Sanger dideoxynucleotide method F Each color is one lane of an electrophoresis

More information

Today s Lecture. Edit graph & alignment algorithms. Local vs global Computational complexity of pairwise alignment Multiple sequence alignment

Today s Lecture. Edit graph & alignment algorithms. Local vs global Computational complexity of pairwise alignment Multiple sequence alignment Today s Lecture Edit graph & alignment algorithms Smith-Waterman algorithm Needleman-Wunsch algorithm Local vs global Computational complexity of pairwise alignment Multiple sequence alignment 1 Sequence

More information

! errors caused by signal attenuation, noise.!! receiver detects presence of errors:!

! errors caused by signal attenuation, noise.!! receiver detects presence of errors:! Daa Link Layer! The Daa Link layer can be furher subdivided ino:!.! Logical Link Conrol (LLC): error and flow conrol!.! Media Access Conrol (MAC): framing and media access! differen link proocols may provide

More information

Computer representations of piecewise

Computer representations of piecewise Edior: Gabriel Taubin Inroducion o Geomeric Processing hrough Opimizaion Gabriel Taubin Brown Universiy Compuer represenaions o piecewise smooh suraces have become vial echnologies in areas ranging rom

More information

Sequencing Alignment I

Sequencing Alignment I Sequencing Alignment I Lectures 16 Nov 21, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall (JHN) 022 1 Outline: Sequence

More information

Sequence Alignment: Mo1va1on and Algorithms. Lecture 2: August 23, 2012

Sequence Alignment: Mo1va1on and Algorithms. Lecture 2: August 23, 2012 Sequence Alignment: Mo1va1on and Algorithms Lecture 2: August 23, 2012 Mo1va1on and Introduc1on Importance of Sequence Alignment For DNA, RNA and amino acid sequences, high sequence similarity usually

More information

Algorithmic Paradigms. Chapter 6 Dynamic Programming. Steps in Dynamic Programming. Dynamic Programming. Dynamic Programming Applications

Algorithmic Paradigms. Chapter 6 Dynamic Programming. Steps in Dynamic Programming. Dynamic Programming. Dynamic Programming Applications lgorithmic Paradigms reed. Build up a solution incrementally, only optimizing some local criterion. hapter Dynamic Programming Divide-and-conquer. Break up a problem into two sub-problems, solve each sub-problem

More information

Lecture 14. Recursion

Lecture 14. Recursion Leture 14 Reursion Announements for Today Prelim 1 Tonight at 5:15 OR 7:30 A D (5:15, Uris G01) E-K (5:15, Statler) L P (7:30, Uris G01) Q-Z (7:30, Statler) Graded y noon on Sun Sores will e in CMS In

More information

BGGN 213 Foundations of Bioinformatics Barry Grant

BGGN 213 Foundations of Bioinformatics Barry Grant BGGN 213 Foundations of Bioinformatics Barry Grant http://thegrantlab.org/bggn213 Recap From Last Time: 25 Responses: https://tinyurl.com/bggn213-02-f17 Why ALIGNMENT FOUNDATIONS Why compare biological

More information

Multiple Sequence Alignment. Mark Whitsitt - NCSA

Multiple Sequence Alignment. Mark Whitsitt - NCSA Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV

More information

CS 314 Principles of Programming Languages

CS 314 Principles of Programming Languages CS 314 Principles of Progrmming Lnguges Lecure 10: Synx Direced Trnslion Zheng (Eddy) Zhng Rugers Universiy Februry 19, 2018 Clss Informion Homework 2 is sill being grded. Projec 1 nd homework 4 will be

More information

Motor Control. 5. Control. Motor Control. Motor Control

Motor Control. 5. Control. Motor Control. Motor Control 5. Conrol In his chaper we will do: Feedback Conrol On/Off Conroller PID Conroller Moor Conrol Why use conrol a all? Correc or wrong? Supplying a cerain volage / pulsewidh will make he moor spin a a cerain

More information

Project #1 Math 285 Name:

Project #1 Math 285 Name: Projec #1 Mah 85 Name: Solving Orinary Differenial Equaions by Maple: Sep 1: Iniialize he program: wih(deools): wih(pdeools): Sep : Define an ODE: (There are several ways of efining equaions, we sar wih

More information

14 Dynamic. Matrix-chain multiplication. P.D. Dr. Alexander Souza. Winter term 11/12

14 Dynamic. Matrix-chain multiplication. P.D. Dr. Alexander Souza. Winter term 11/12 Algorithms Theory 14 Dynamic Programming (2) Matrix-chain multiplication P.D. Dr. Alexander Souza Optimal substructure Dynamic programming is typically applied to optimization problems. An optimal solution

More information