Computational Biology
|
|
- Abner Pitts
- 6 years ago
- Views:
Transcription
1 Compuaional Bioloy A.P. Gulyaev (Saha) Appliaion oriened view appliaion H.J. Hooeboom (Hendrik Jan) Theory oriened view
2 hemes problem model (e. raph) known alorihms haraerizaion unpreise daa omplexiy heurisis wha is he rih answer?
3 enral doma DNA RNA ransripion & spliin proein eiwi ranslaion ene expression
4 wo alphabes DNA bases 4 symbols a RNA a u proeins amino aids 2 symbols A R D N C E Q G H I L K M F P S T W Y V
5 reursion answer quesion
6 reursion: bad example a = a = a n+ = a n +a n (n ) (e.)
7 reursion: dynami prorammin a = a = a n+ = a n +a n (n ),,, 2, 3, 5, 8, 3, 2, dynami prorammin memoizaion sore resuls in able ( work boomup )
8 sruure of RNA sequene sruure funion 2D sruure 3D sruure hp://al.sie.nnu.edu.w/ourse/bioloy/slide_bioloy.pp
9 sequene alinmen TCAGACGATTG TCGGAGCTG inserion deleion subsiuion mah mismah ap TCAGACGATTG TCGGAGCTG TCAGACGATTG TCGGAGCTG TCAGACGATTG TCGGAGCTG
10 sequene alinmen TCAGACGATTG TCGGAGCTG TCAGACGATTG TCGGAGCTG TCAGACGATTG TCGGAGCTG 46=8 23=7 mah mismah ap +2 TCAGACGATTG TCGGAGCTG 44=9
11 basi alorihm alinmen reursive priniple dynami prorammin
12 alinmen: reursion a a a a a a σ(,x) = σ(x,) = σ(x,y) = σ(x,x) = 2 reward and punishmen a a
13 dynami prorammin a a a a * a a
14 dynami prorammin a a a a a a
15 iniializaion a a a
16 dynami prorammin i a[i,j] = max a j a a[i,j] + a[i,j] + σ( s[i],[j] ) a[i,j] + a a a a +2 a a a a
17 alinmen a a a a
18 raebak a a a a a a a a a a
19 /* Reursion: he hear of he DP alorihm.*/ /* Iniializaion. */ S[][] = ; for (i = ; i <= M; i++) S[i][] = i * INDEL; for (j = ; j <= N; j++) S[][j] = j * INDEL; Eddy S.R. (24a) /* Dynami prorammin, lobal alinmen (Needleman/Wunsh) reursion. */ for (i = ; i <= M; i++) for (j = ; j <= N; j++) { /* ase #: i,j are alined */ if (x[i x[i] == y[j]) S[i][j] ] = S[i][j ][j] + MATCH; else S[i][j] ] = S[i][j ][j] + MISMATCH; s = S[i][j] + INDEL; /* ase #2: i alined o */ if (s > S[i][j]) ]) S[i][j] ] = s; } s = S[i][j] + INDEL; /* ase #3: j alined o */ if (s > S[i][j]) ]) S[i][j] ] = s; /* The resul (opimal alinmen sore) is now in S[M][N]. */
20 sorin and parameer hoie A A A C AT TA vs. vs. vs. A C A C AT TA mah mismah ap M m A C G T A C 25 3 G 4 T 9 ap 4 + 3k ask your favourie moleular biolois!
21 PAM25 Marix deails noes APG biohemial properies muaion prob (evoluion)
22 alinmen CAGCACTTGGATTCTCGG CAGCGTGG CAGCACTTGGATTCTCGG CAGCGTGG
23 varians of alinmen > lobal Needleman & Wunsh loal Smih & Waerman semilobal end
24 loal alinmen a[i,j] = max a[i,j] + a[i,j] + σ( s[i],[j] ) a[i,j] + max soluion (raebak) from max o
25 loal alinmen max
26 end alinmen s iniial ap ssssssssssss max final ap iniializaion wih zero s max on border(s)
27 savin spae O(mn) boh spae & ime Hirshber: linear spae j [ i] [ j] [i m] [j n] i T(m,n) 2mn T(m,n) mn/2 + mn/2 + T(i,n/2)+T(ni,n/2) mn + in + (mi)n = 2mn
28 savin spae O(mn) boh spae & ime Hirshber: linear spae j [ i] [ j] [i m] [j n] i +/2+/4+ = 2
29 eneral ap penalies (k) = k (k) = +ke (k) ap penaly open ap, exend ap arbirary os sandard eneral affine ap lenh
30 a a dynami prorammin b wih hree maries a a a a a a a a a a a a a a a a a a b
31 affine ap penalies dynami prorammin wih hree maries (k) = +ke open ap, exend ap b[i,j]= max a[i,j] e b[i,j] e [i,j] e ap was already open j a a a a i a a b O(mn ) vs. O(mn 2 + m 2 n ) eneral ap penaly
32 omparin similar sequenes O(mn) quadrai boh spae & ime redue ime k depends on number of dashes k banded alinmen linear ime heurisi se k based on upper bound for alinmen exa while improvemen do k = 2k
33 alinin several sequenes aidi ribosomal proein P homolo (LE) enoded by he Rplp ene
34 omparin muliple sequenes how o sore? SP sumofpairs pairs of symbols pairs of srins deails noes APG A C T G G G A A T G C G A A C T C C C dynami prorammin possible bu oo muh spae & ime heurisi redue searh spae (banded alinmen) problem is NPomplee (# srins = dimension!) heurisi sar alinmen / proressive alinmen hidden Markov model
35 sar alinmen srin in ener (whih one?) ompue pairwise alinmens exend pairs ino muliple alinmen one a ap, always a ap O(k 2 m 2 ) k sequenes, m lenh heory: wihin faor 2 of opimal alinmen
36 sar alinmen ATTGCCATT 2 ATGGCCATT 3 ATCCAATTTT 4 ATCTTCTT 5 ACTGACC ATTGCCATT 2 ATGGCCATT ATTGCCATT 3 ATCCAATTTT ATTGCCATT 4 ATCTTCTT ATTGCCATT 5 ACTGACC ATTGCCATT 2 ATGGCCATT 3 ATCCAATTTT ATTGCCATT 2 ATGGCCATT 3 ATCCAATTTT 4 ATCTTCTT 5 ACTGACC
37 uide ree boomup sequenes in leaves proressive alinmen ree known evoluionary relaion build ree luserin alo s ClusalW inner nodes ombine alinmens (profiles varian basi alo)
38 probleem solved!? muh oo slow lon srins hue daabases heurisis FASTA alon diaonal BLAST minimal lose mah muliple alinmen (several srins) NP omplee exponenial
39 human enome saisis 23 pairs of hromosomes 3. 9 nuleoide bases avarae 3 bases / ene dysrophin 2.4 million 3, 4, enes proein varians million (spliin) 99.9% exaly he same in humans
40 Basi Loal Alinmen Searh Tools query query word (W=3) GSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNL neihbourhood words hreshold PQG 8 PEG 5 PRG 4 PMG 3 PQA 2 PQN 2 SLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNL TLASVLDCTVTPMGSRMLKRWLHMPVRDTRVLLERQQT subje hihsorin semen pair (HSP) parameers: W word size T hreshold S sore E expeed
Computational Biology 6.095/6.895 Database Search Lecture 5 Prof. Piotr Indyk
Computational Biology 6.095/6.895 Database Searh Leture 5 Prof. Piotr Indyk Previous letures Leture -3: Global alignment in O(mn) Dynami programming Leture -2: Loal alignment, variants, in O(mn) Leture
More informationPairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University
1 Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment 2 The number of all possible pairwise alignments (if gaps are allowed)
More informationUsing CANopen Slave Driver
CAN Bus User Manual Using CANopen Slave Driver V1. Table of Conens 1. SDO Communicaion... 1 2. PDO Communicaion... 1 3. TPDO Reading and RPDO Wriing... 2 4. RPDO Reading... 3 5. CANopen Communicaion Parameer
More informationSam knows that his MP3 player has 40% of its battery life left and that the battery charges by an additional 12 percentage points every 15 minutes.
8.F Baery Charging Task Sam wans o ake his MP3 player and his video game player on a car rip. An hour before hey plan o leave, he realized ha he forgo o charge he baeries las nigh. A ha poin, he plugged
More informationPairwise Sequence Alignment: Dynamic Programming Algorithms. COMP Spring 2015 Luay Nakhleh, Rice University
Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 - Spring 2015 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment The number of all possible pairwise alignments (if
More informationReconstructing long sequences from overlapping sequence fragment. Searching databases for related sequences and subsequences
SEQUENCE ALIGNMENT ALGORITHMS 1 Why compare sequences? Reconstructing long sequences from overlapping sequence fragment Searching databases for related sequences and subsequences Storing, retrieving and
More informationGauss-Jordan Algorithm
Gauss-Jordan Algorihm The Gauss-Jordan algorihm is a sep by sep procedure for solving a sysem of linear equaions which may conain any number of variables and any number of equaions. The algorihm is carried
More informationData Structures and Algorithms. The material for this lecture is drawn, in part, from The Practice of Programming (Kernighan & Pike) Chapter 2
Daa Srucures and Algorihms The maerial for his lecure is drawn, in par, from The Pracice of Programming (Kernighan & Pike) Chaper 2 1 Moivaing Quoaion Every program depends on algorihms and daa srucures,
More informationOptimal Crane Scheduling
Opimal Crane Scheduling Samid Hoda, John Hooker Laife Genc Kaya, Ben Peerson Carnegie Mellon Universiy Iiro Harjunkoski ABB Corporae Research EWO - 13 November 2007 1/16 Problem Track-mouned cranes move
More informationLecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD
Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Assumptions: Biological sequences evolved by evolution. Micro scale changes: For short sequences (e.g. one
More informationData Structures and Algorithms
Daa Srucures and Algorihms The maerial for his lecure is drawn, in ar, from The Pracice of Programming (Kernighan & Pike) Chaer 2 1 Goals of his Lecure Hel you learn (or refresh your memory) abou: Common
More informationBioinformatics for Biologists
Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover
More informationThe Advice Complexity of a Class of Hard Online Problems
The Advie Complexiy of a Class of Hard Online Problems Joan Boyar, Lene M. Favrhold, Chrisian Kudahl, and Jesper W. Mikkelsen Deparmen of Mahemais and Compuer Siene Universiy of Souhern Denmark July 1,
More informationCAMERA CALIBRATION BY REGISTRATION STEREO RECONSTRUCTION TO 3D MODEL
CAMERA CALIBRATION BY REGISTRATION STEREO RECONSTRUCTION TO 3D MODEL Klečka Jan Docoral Degree Programme (1), FEEC BUT E-mail: xkleck01@sud.feec.vubr.cz Supervised by: Horák Karel E-mail: horak@feec.vubr.cz
More informationComputational Molecular Biology
Computational Molecular Biology Erwin M. Bakker Lecture 2 Materials used from R. Shamir [2] and H.J. Hoogeboom [4]. 1 Molecular Biology Sequences DNA A, T, C, G RNA A, U, C, G Protein A, R, D, N, C E,
More informationElastic web processing lines : optimal tension and velocity closed loop bandwidths
Elasi web proessing lines : opimal ension and veloiy losed loop bandwidhs Dominique KNIEL, Prof Web Handling Researh Group, Universiy of Srasbourg, Frane kniel@unisra.fr 6 AIMCAL Web Coaing & Handling
More informationChapter 4: Blast. Chaochun Wei Fall 2014
Course organization Introduction ( Week 1-2) Course introduction A brief introduction to molecular biology A brief introduction to sequence comparison Part I: Algorithms for Sequence Analysis (Week 3-11)
More informationReal Time Integral-Based Structural Health Monitoring
Real Time Inegral-Based Srucural Healh Monioring The nd Inernaional Conference on Sensing Technology ICST 7 J. G. Chase, I. Singh-Leve, C. E. Hann, X. Chen Deparmen of Mechanical Engineering, Universiy
More informationMultiple Sequence Alignment
. Multiple Sequence lignment utorial #4 Ilan ronau Multiple Sequence lignment Reminder S = S = S = Possible alignment Possible alignment Multiple Sequence lignment Reminder Input: Sequences S, S,, S over
More informationQuantitative macro models feature an infinite number of periods A more realistic (?) view of time
INFINIE-HORIZON CONSUMPION-SAVINGS MODEL SEPEMBER, Inroducion BASICS Quaniaive macro models feaure an infinie number of periods A more realisic (?) view of ime Infinie number of periods A meaphor for many
More information4. Minimax and planning problems
CS/ECE/ISyE 524 Inroducion o Opimizaion Spring 2017 18 4. Minima and planning problems ˆ Opimizing piecewise linear funcions ˆ Minima problems ˆ Eample: Chebyshev cener ˆ Muli-period planning problems
More informationToday. Quiz Introduction to pipelining
Pipelining 1 Tody Quiz Inroduion o pipelining 2 Pipelining 10ns (10ns) 20ns (10ns) 30ns (10ns) Wh s he leny for one uni of work? Wh s he hroughpu? Pipelining 1.Brek up he logi wih lhes ino pipeline sges
More informationAssignment 2. Due Monday Feb. 12, 10:00pm.
Faculy of rs and Science Universiy of Torono CSC 358 - Inroducion o Compuer Neworks, Winer 218, LEC11 ssignmen 2 Due Monday Feb. 12, 1:pm. 1 Quesion 1 (2 Poins): Go-ack n RQ In his quesion, we review how
More informationEECS 487: Interactive Computer Graphics
EECS 487: Ineracive Compuer Graphics Lecure 7: B-splines curves Raional Bézier and NURBS Cubic Splines A represenaion of cubic spline consiss of: four conrol poins (why four?) hese are compleely user specified
More informationBI-TEMPORAL INDEXING
BI-TEMPORAL INDEXING Mirella M. Moro Uniersidade Federal do Rio Grande do Sul Poro Alegre, RS, Brazil hp://www.inf.ufrgs.br/~mirella/ Vassilis J. Tsoras Uniersiy of California, Rierside Rierside, CA 92521,
More informationCOMP26120: Algorithms and Imperative Programming
COMP26120 ecure C3 1/48 COMP26120: Algorihms and Imperaive Programming ecure C3: C - Recursive Daa Srucures Pee Jinks School of Compuer Science, Universiy of Mancheser Auumn 2011 COMP26120 ecure C3 2/48
More information1 œ DRUM SET KEY. 8 Odd Meter Clave Conor Guilfoyle. Cowbell (neck) Cymbal. Hi-hat. Floor tom (shell) Clave block. Cowbell (mouth) Hi tom.
DRUM SET KEY Hi-ha Cmbal Clave block Cowbell (mouh) 0 Cowbell (neck) Floor om (shell) Hi om Mid om Snare Floor om Snare cross sick or clave block Bass drum Hi-ha wih foo 8 Odd Meer Clave Conor Guilfole
More informationUgail H (2007): "3D Data Modelling and Processing using Partial Differential Equations", Advances and Applications of Dezert-Smarandache Theory for
Ugail H (7): "3D Daa Modelling and Proessing using Parial Differenial Equaions", Advanes and Appliaions of Dezer-Smarandahe Theory for Plausible and Paradoxial Reasoning for Informaion Fusion, Bulgarian
More informationLocal Alignment & Gap Penalties CMSC 423
Local Alignment & ap Penalties CMSC 423 lobal, Semi-global, Local Alignments Last time, we saw a dynamic programming algorithm for global alignment: both strings s and t must be completely matched: s t
More informationCENG 477 Introduction to Computer Graphics. Modeling Transformations
CENG 477 Inroducion o Compuer Graphics Modeling Transformaions Modeling Transformaions Model coordinaes o World coordinaes: Model coordinaes: All shapes wih heir local coordinaes and sies. world World
More informationPART 1 REFERENCE INFORMATION CONTROL DATA 6400 SYSTEMS CENTRAL PROCESSOR MONITOR
. ~ PART 1 c 0 \,).,,.,, REFERENCE NFORMATON CONTROL DATA 6400 SYSTEMS CENTRAL PROCESSOR MONTOR n CONTROL DATA 6400 Compuer Sysems, sysem funcions are normally handled by he Monior locaed in a Peripheral
More informationNEWTON S SECOND LAW OF MOTION
Course and Secion Dae Names NEWTON S SECOND LAW OF MOTION The acceleraion of an objec is defined as he rae of change of elociy. If he elociy changes by an amoun in a ime, hen he aerage acceleraion during
More informationFrom [4] D. Gusfield. Algorithms on Strings, Trees and Sequences. Cambridge University Press, New York, 1997.
Multiple Alignment From [4] D. Gusfield. Algorithms on Strings, Trees and Sequences. Cambridge University Press, New York, 1997. 1 Multiple Sequence Alignment Introduction Very active research area Very
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 04: Variations of sequence alignments http://www.pitt.edu/~mcs2/teaching/biocomp/tutorials/global.html Slides adapted from Dr. Shaojie Zhang (University
More informationCS 152 Computer Architecture and Engineering. Lecture 7 - Memory Hierarchy-II
CS 152 Compuer Archiecure and Engineering Lecure 7 - Memory Hierarchy-II Krse Asanovic Elecrical Engineering and Compuer Sciences Universiy of California a Berkeley hp://www.eecs.berkeley.edu/~krse hp://ins.eecs.berkeley.edu/~cs152
More informationPiecewise Linear Models
6-6 Applied Operaions Research Piecewise Linear Models Deparmen of Mahemaics and Saisics The Universi of Melbourne This presenaion has been made in accordance wih he provisions of Par VB of he coprigh
More informationSequence Alignment. COMPSCI 260 Spring 2016
Sequence Alignment COMPSCI 260 Spring 2016 Why do we want to compare DNA or protein sequences? Find genes similar to known genes IdenGfy important (funcgonal) sequences by finding conserved regions As
More informationDynamic Programming (cont d) CS 466 Saurabh Sinha
Dynamic Programming (cont d) CS 466 Saurabh Sinha Spliced Alignment Begins by selecting either all putative exons between potential acceptor and donor sites or by finding all substrings similar to the
More informationComputational Molecular Biology
Computational Molecular Biology Erwin M. Bakker Lecture 3, mainly from material by R. Shamir [2] and H.J. Hoogeboom [4]. 1 Pairwise Sequence Alignment Biological Motivation Algorithmic Aspect Recursive
More informationMARSS Reference Sheet
MARSS Reference Shee The defaul MARSS model (form="marxss") is wrien as follows: x = B x 1 + u + C c + w where w MVN( Q ) y = Z x + a + D d + v where v MVN( R ) x 1 MVN(π Λ) or x MVN(π Λ) c and d are inpus
More informationRay Casting. Outline. Outline in Code
Foundaions of ompuer Graphics Online Lecure 10: Ray Tracing 2 Nus and ols amera Ray asing Ravi Ramamoorhi Ouline amera Ray asing (choose ray direcions) Ray-objec inersecions Ray-racing ransformed objecs
More informationBiology 644: Bioinformatics
Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find
More informationA Hybrid Genetic Algorithm-Simulated Annealing for Integrated Production-Distribution Scheduling in Supply Chain Management
Engineering Mahemais 2017; 2(1): 31-40 hp://www.sienepublishinggroup.om//engmah doi: 10.11648/.engmah.20170201.15 A Hybrid Genei Algorihm-Simulaed Annealing for Inegraed Produion-Disribuion Sheduling in
More informationMATH Differential Equations September 15, 2008 Project 1, Fall 2008 Due: September 24, 2008
MATH 5 - Differenial Equaions Sepember 15, 8 Projec 1, Fall 8 Due: Sepember 4, 8 Lab 1.3 - Logisics Populaion Models wih Harvesing For his projec we consider lab 1.3 of Differenial Equaions pages 146 o
More informationAn Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST
An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise
More informationImplementing Ray Casting in Tetrahedral Meshes with Programmable Graphics Hardware (Technical Report)
Implemening Ray Casing in Terahedral Meshes wih Programmable Graphics Hardware (Technical Repor) Marin Kraus, Thomas Erl March 28, 2002 1 Inroducion Alhough cell-projecion, e.g., [3, 2], and resampling,
More informationAs of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be
48 Bioinformatics I, WS 09-10, S. Henz (script by D. Huson) November 26, 2009 4 BLAST and BLAT Outline of the chapter: 1. Heuristics for the pairwise local alignment of two sequences 2. BLAST: search and
More informationRay Tracing II. Improving Raytracing Speed. Improving Computational Complexity. Raytracing Computational Complexity
Ra Tracing II Iproving Raracing Speed Copuer Graphics Ra Tracing II 2005 Fabio Pellacini 1 Copuer Graphics Ra Tracing II 2005 Fabio Pellacini 2 Raracing Copuaional Coplei ra-scene inersecion is epensive
More informationLecture 18: Mix net Voting Systems
6.897: Advanced Topics in Crypography Apr 9, 2004 Lecure 18: Mix ne Voing Sysems Scribed by: Yael Tauman Kalai 1 Inroducion In he previous lecure, we defined he noion of an elecronic voing sysem, and specified
More informationUML in Action. A Two-Layered Interpretation for Testing. Bernhard K. Aichernig Joint work with Harald Brandl, Elisabeth Jöbstl, Willibald Krenn
Insiue for Sofware Technology A Two-Layered Inerpreaion for Tesing Bernhard K. Aichernig Join work wih Harald Brandl, Elisabeh Jöbsl, Willibald Krenn Insiue for Sofware Technology Graz Universiy of Technology
More informationAutomatic 3D Facial Expression Editing in Videos
Auomai 3D Faial Expression Ediing in Videos Ya Chang, Marelo Vieira 2, Mahew Turk, Luiz Velho 2 Universiy of California, ana Barbara 2 IMPA Insiuo de Maemaia Pura e Apliada Absra In his paper, we inrodue
More informationSTEREO PLANE MATCHING TECHNIQUE
STEREO PLANE MATCHING TECHNIQUE Commission III KEY WORDS: Sereo Maching, Surface Modeling, Projecive Transformaion, Homography ABSTRACT: This paper presens a new ype of sereo maching algorihm called Sereo
More informationCMPSC 274: Transac0on Processing Lecture #6: Concurrency Control Protocols
CMPSC 274: Transac0on Processing Lecure #6: Concurrency Conrol Proocols Divy Agrawal Deparmen of Compuer Science UC Sana Barbara 4.4.1 Timesamp Ordering 4.4.2 Serializa0on Graph Tes0ng 4.4.3 Op0mis0c Proocols
More informationLecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:
Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating
More informationImage Content Representation
Image Conen Represenaion Represenaion for curves and shapes regions relaionships beween regions E.G.M. Perakis Image Represenaion & Recogniion 1 Reliable Represenaion Uniqueness: mus uniquely specify an
More informationAdding Time to an Object-Oriented Versions Model
Insiuo de Informáica Universidade Federal do Rio Grande do Sul Poro Alegre - RS - BRAZIL Adding Time o an Objec-Oriened Versions Model Mirella Moura Moro Nina Edelweiss Silvia Maria Saggiorao Clesio Saraiva
More informationSequence Alignment & Search
Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version
More information24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:
24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid
More informationImage segmentation. Motivation. Objective. Definitions. A classification of segmentation techniques. Assumptions for thresholding
Moivaion Image segmenaion Which pixels belong o he same objec in an image/video sequence? (spaial segmenaion) Which frames belong o he same video sho? (emporal segmenaion) Which frames belong o he same
More informationHidden Markov Model and Chapman Kolmogrov for Protein Structures Prediction from Images
Hidden Markov Model and Chapman Kolmogrov for Proein Srucures Predicion from Images Md.Sarwar Kamal 1, Linkon Chowdhury 2, Mohammad Ibrahim Khan 2, Amira S. Ashour 3, João Manuel R.S. Tavares 4, Nilanjan
More informationCISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment
CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features
More informationIt is easier to visualize plotting the curves of cos x and e x separately: > plot({cos(x),exp(x)},x = -5*Pi..Pi,y = );
Mah 467 Homework Se : some soluions > wih(deools): wih(plos): Warning, he name changecoords has been redefined Problem :..7 Find he fixed poins, deermine heir sabiliy, for x( ) = cos x e x > plo(cos(x)
More informationEffects needed for Realism. Ray Tracing. Ray Tracing: History. Outline. Foundations of Computer Graphics (Fall 2012)
Foundaions of ompuer Graphics (Fall 2012) S 184, Lecure 16: Ray Tracing hp://ins.eecs.berkeley.edu/~cs184 Effecs needed for Realism (Sof) Shadows Reflecions (Mirrors and Glossy) Transparency (Waer, Glass)
More informationTCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology?
Local Sequence Alignment & Heuristic Local Aligners Lectures 18 Nov 28, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall
More informationMouse, Human, Chimpanzee
More Alignments 1 Mouse, Human, Chimpanzee Mouse to Human Chimpanzee to Human 2 Mouse v.s. Human Chromosome X of Mouse to Human 3 Local Alignment Given: two sequences S and T Find: substrings of S and
More informationHeuristic methods for pairwise alignment:
Bi03c_1 Unit 03c: Heuristic methods for pairwise alignment: k-tuple-methods k-tuple-methods for alignment of pairs of sequences Bi03c_2 dynamic programming is too slow for large databases Use heuristic
More information1.4 Application Separable Equations and the Logistic Equation
1.4 Applicaion Separable Equaions and he Logisic Equaion If a separable differenial equaion is wrien in he form f ( y) dy= g( x) dx, hen is general soluion can be wrien in he form f ( y ) dy = g ( x )
More informationOutline. Sequence Alignment. Types of Sequence Alignment. Genomics & Computational Biology. Section 2. How Computers Store Information
enomics & omputational Biology Section Lan Zhang Sep. th, Outline How omputers Store Information Sequence lignment Dot Matrix nalysis Dynamic programming lobal: NeedlemanWunsch lgorithm Local: SmithWaterman
More informationDynamic Programming part 2
Dynamic Programming part 2 Week 7 Objectives More dynamic programming examples - Matrix Multiplication Parenthesis - Longest Common Subsequence Subproblem Optimal structure Defining the dynamic recurrence
More informationTUTORING TEXTS IN MATHCAD
TUTORING TEXTS IN MATHCAD MIROSLAV DOLOZÍILEK and ANNA RYNDOVÁ Faculy of Mechanical Engineering, Brno Universiy of Technology Technická, 616 69 Brno, Czech Republic E-ail: irdo@fyzika.fe.vubr.cz Absrac
More informationEvaluation and Improvement of Region-based Motion Segmentation
Evaluaion and Improvemen of Region-based Moion Segmenaion Mark Ross Universiy Koblenz-Landau, Insiue of Compuaional Visualisics, Universiässraße 1, 56070 Koblenz, Germany Email: ross@uni-koblenz.de Absrac
More informationMultiple Alignment. From [4] D. Gusfield. Algorithms on Strings, Trees and Sequences. Cambridge University Press, New York, 1997.
Multiple Alignment From [4] D. Gusfield. Algorithms on Strings, Trees and Sequences. Cambridge University Press, New York, 1997. 1 Multiple Sequence Alignment Introduction Very active research area Very
More informationDynamic Programming. Lecture #8 of Algorithms, Data structures and Complexity. Joost-Pieter Katoen Formal Methods and Tools Group
Dynami Programming Leture #8 of Algorithms, Data strutures and Complexity Joost-Pieter Katoen Formal Methods and Tools Group E-mail: katoen@s.utwente.nl Otober 29, 2002 JPK #8: Dynami Programming ADC (214020)
More informationRepresenting Non-Manifold Shapes in Arbitrary Dimensions
Represening Non-Manifold Shapes in Arbirary Dimensions Leila De Floriani,2 and Annie Hui 2 DISI, Universiy of Genova, Via Dodecaneso, 35-646 Genova (Ialy). 2 Deparmen of Compuer Science, Universiy of Maryland,
More informationFastA & the chaining problem
FastA & the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 1 Sources for this lecture: Lectures by Volker Heun, Daniel Huson and Knut Reinert,
More informationME 406 Assignment #1 Solutions
Assignmen#1Sol.nb 1 ME 406 Assignmen #1 Soluions PROBLEM 1 We define he funcion for Mahemaica. In[1]:= f@_d := Ep@D - 4 Sin@D (a) We use Plo o consruc he plo. In[2]:= Plo@f@D, 8, -5, 5
More informationGaps ATTACGTACTCCATG ATTACGT CATG. In an edit script we need 4 edit operations for the gap of length 4.
Gaps ATTACGTACTCCATG ATTACGT CATG In an edit script we need 4 edit operations for the gap of length 4. In maximal score alignments we treat the dash " " like any other character, hence we charge the s(x,
More informationNonparametric CUSUM Charts for Process Variability
Journal of Academia and Indusrial Research (JAIR) Volume 3, Issue June 4 53 REEARCH ARTICLE IN: 78-53 Nonparameric CUUM Chars for Process Variabiliy D.M. Zombade and V.B. Ghue * Dep. of aisics, Walchand
More informationFastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:
FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:56 4001 4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem
More informationMOBILE COMPUTING. Wi-Fi 9/20/15. CSE 40814/60814 Fall Wi-Fi:
MOBILE COMPUTING CSE 40814/60814 Fall 2015 Wi-Fi Wi-Fi: name is NOT an abbreviaion play on Hi-Fi (high fideliy) Wireless Local Area Nework (WLAN) echnology WLAN and Wi-Fi ofen used synonymous Typically
More informationMOBILE COMPUTING 3/18/18. Wi-Fi IEEE. CSE 40814/60814 Spring 2018
MOBILE COMPUTING CSE 40814/60814 Spring 2018 Wi-Fi Wi-Fi: name is NOT an abbreviaion play on Hi-Fi (high fideliy) Wireless Local Area Nework (WLAN) echnology WLAN and Wi-Fi ofen used synonymous Typically
More informationA non-stationary uniform tension controlled interpolating 4-point scheme reproducing conics
A non-saionary uniform ension conrolled inerpolaing 4-poin scheme reproducing conics C. Beccari a, G. Casciola b, L. Romani b, a Deparmen of Pure and Applied Mahemaics, Universiy of Padova, Via G. Belzoni
More informationAcceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion.
www.ijarcet.org 54 Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. Hassan Kehinde Bello and Kazeem Alagbe Gbolagade Abstract Biological sequence alignment is becoming popular
More informationREDUCTIONS BBM ALGORITHMS DEPT. OF COMPUTER ENGINEERING ERKUT ERDEM. Bird s-eye view. May. 12, Reduction.
BBM 0 - ALGORITHMS DEPT. OF COMPUTER ENGINEERING ERKUT ERDEM REDUCTIONS May., 0 Bird s-eye view Desideraa. Classify problems according o compuaional requiremens. complexiy order of growh examples linear
More informationShortest Path Algorithms. Lecture I: Shortest Path Algorithms. Example. Graphs and Matrices. Setting: Dr Kieran T. Herley.
Shores Pah Algorihms Background Seing: Lecure I: Shores Pah Algorihms Dr Kieran T. Herle Deparmen of Compuer Science Universi College Cork Ocober 201 direced graph, real edge weighs Le he lengh of a pah
More informationSequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC--
Sequence Alignment Sequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC-- TAG-CTATCAC--GACCGC--GGTCGATTTGCCCGAC Distance from sequences
More informationBioinformatics. Sequence alignment BLAST Significance. Next time Protein Structure
Bioinformatics Sequence alignment BLAST Significance Next time Protein Structure 1 Experimental origins of sequence data The Sanger dideoxynucleotide method F Each color is one lane of an electrophoresis
More informationToday s Lecture. Edit graph & alignment algorithms. Local vs global Computational complexity of pairwise alignment Multiple sequence alignment
Today s Lecture Edit graph & alignment algorithms Smith-Waterman algorithm Needleman-Wunsch algorithm Local vs global Computational complexity of pairwise alignment Multiple sequence alignment 1 Sequence
More information! errors caused by signal attenuation, noise.!! receiver detects presence of errors:!
Daa Link Layer! The Daa Link layer can be furher subdivided ino:!.! Logical Link Conrol (LLC): error and flow conrol!.! Media Access Conrol (MAC): framing and media access! differen link proocols may provide
More informationComputer representations of piecewise
Edior: Gabriel Taubin Inroducion o Geomeric Processing hrough Opimizaion Gabriel Taubin Brown Universiy Compuer represenaions o piecewise smooh suraces have become vial echnologies in areas ranging rom
More informationSequencing Alignment I
Sequencing Alignment I Lectures 16 Nov 21, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall (JHN) 022 1 Outline: Sequence
More informationSequence Alignment: Mo1va1on and Algorithms. Lecture 2: August 23, 2012
Sequence Alignment: Mo1va1on and Algorithms Lecture 2: August 23, 2012 Mo1va1on and Introduc1on Importance of Sequence Alignment For DNA, RNA and amino acid sequences, high sequence similarity usually
More informationAlgorithmic Paradigms. Chapter 6 Dynamic Programming. Steps in Dynamic Programming. Dynamic Programming. Dynamic Programming Applications
lgorithmic Paradigms reed. Build up a solution incrementally, only optimizing some local criterion. hapter Dynamic Programming Divide-and-conquer. Break up a problem into two sub-problems, solve each sub-problem
More informationLecture 14. Recursion
Leture 14 Reursion Announements for Today Prelim 1 Tonight at 5:15 OR 7:30 A D (5:15, Uris G01) E-K (5:15, Statler) L P (7:30, Uris G01) Q-Z (7:30, Statler) Graded y noon on Sun Sores will e in CMS In
More informationBGGN 213 Foundations of Bioinformatics Barry Grant
BGGN 213 Foundations of Bioinformatics Barry Grant http://thegrantlab.org/bggn213 Recap From Last Time: 25 Responses: https://tinyurl.com/bggn213-02-f17 Why ALIGNMENT FOUNDATIONS Why compare biological
More informationMultiple Sequence Alignment. Mark Whitsitt - NCSA
Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV
More informationCS 314 Principles of Programming Languages
CS 314 Principles of Progrmming Lnguges Lecure 10: Synx Direced Trnslion Zheng (Eddy) Zhng Rugers Universiy Februry 19, 2018 Clss Informion Homework 2 is sill being grded. Projec 1 nd homework 4 will be
More informationMotor Control. 5. Control. Motor Control. Motor Control
5. Conrol In his chaper we will do: Feedback Conrol On/Off Conroller PID Conroller Moor Conrol Why use conrol a all? Correc or wrong? Supplying a cerain volage / pulsewidh will make he moor spin a a cerain
More informationProject #1 Math 285 Name:
Projec #1 Mah 85 Name: Solving Orinary Differenial Equaions by Maple: Sep 1: Iniialize he program: wih(deools): wih(pdeools): Sep : Define an ODE: (There are several ways of efining equaions, we sar wih
More information14 Dynamic. Matrix-chain multiplication. P.D. Dr. Alexander Souza. Winter term 11/12
Algorithms Theory 14 Dynamic Programming (2) Matrix-chain multiplication P.D. Dr. Alexander Souza Optimal substructure Dynamic programming is typically applied to optimization problems. An optimal solution
More information