Bioinformatics. Sequence alignment BLAST Significance. Next time Protein Structure

Size: px
Start display at page:

Download "Bioinformatics. Sequence alignment BLAST Significance. Next time Protein Structure"

Transcription

1 Bioinformatics Sequence alignment BLAST Significance Next time Protein Structure 1

2 Experimental origins of sequence data The Sanger dideoxynucleotide method F Each color is one lane of an electrophoresis gel.

3 A A A T T A A T AAAAATTTTAT Building an alignment starts with a scoring matrix. In its simplest form, a dot plot. Everything aligned to everything.

4 A A A T T A A T AAAAATTTTAT An alignment is a path through the scoring matrix, always proceeding to the right and down. (no non-sequential alignments allowed.)

5 A A A T T A A T AAAAATTTTAT Unbroken diagonals represent blocks of sequence without indels.

6 BLOSUM62: protein substitution matrix

7 PAM250

8 Bioinformatics Sequence alignment BLAST Significance Next time Protein Structure 8

9 Database searching one sequence enbank, PIR, Swissprot, enembl, DDBJ lots of sequences Why do a database search? Mol. Bio: Determination of gene function. Primer design. Pathology, epidemiology, ecology: Determination of species, strain, lineage, phylogeny. Biophysics: Prediction of RNA or protein structure, effect of mutation.

10 Searching millions of sequences iven a protein or DNA sequence, we want to find all of the sequences in enbank (over 17 million sequences!!) that have a good alignment score. Each alignment score should be the optimal score (or a close approximation). How do we do it?

11 Fast Database Searching BLAST S. Altschul et al. First make a set of lookup tables for all 3-letter (protein) or 11-letter (DNA) matches. Make another lookup table: the locations of all 3-letter words in the database. Start with a match, extend to the left and right until the score no longer increases. Very fast. Selective, but not as sensitive as slower search methods (SSEARH). Reliable statistics. Heuristic, not optimal.

12 BLAST, precalculations All 8000 possible 3-tuples... PQ PQ PR PS... PT PV PW PY PAQ PQ PDQ PEQ PFQ high-scoring 3-tuples Each 3-tuple is scored against all 8000 possible 3-tuples using BLOSUM. The top scoring 50 are kept as that 3tuple s neighborhood words

13 BLAST query sequence target sequence a 3-tuple neighborhood words for 3-tuple identity matches seeds HSPs For every 3-residue window, we get the set of 50 nearest neighbors. Use each word to get identity matches (seeds). Then extend the seed alignments as long as the score increases.

14 BLAST HSPs alignment The best extended seeds are called HSPs (high scoring pairs). The top scoring HSP is picked first, then the second (as long as it falls "northwest" or "southeast" of the first.), and so on.

15 BLAST -- last steps» Local Dynamic Programming (DP) alignment is applied to only the sequences that pass the FASTA score cutoff.» DP scores are converted to e-values.» Local alignments are output for the top hits.» Optionally, multiple sequence alignment output ("star" alignment) 15

16 Protein Databases available for BLAST search On BLAST search page, select.a database to search and then select? to learn a little about that database. 16

17 Protein Databases available for BLAST search On BLAST search page, select.a database to search and then select? to learn a little about that database. 17

18 Protein Databases available for BLAST search On BLAST search page, select.a database to search and then select? to learn a little about that database. 18

19 BLAST -- Filters You can restrict the search by Taxonomy You can enter a Entrez search query to restrict the search. (Test your Entrez query first) (Learn about Entrez here: Watch this! 19

20 Entrez 20

21 Other forms of BLAST BLAST query database blastn nucleotide nucleotide blastp protein protein tblastn protein translated DNA blastx translated DNA protein tblastx translated DNA translated DNA psi-blast protein, profile protein phi-blast pattern protein transitive blast* any any *not really a blast. Just a way of using blast. 21

22 Psi-BLAST: Blast with profiles Psi-BLAST searches the database iteratively. (ycle 1) Normal BLAST (with gaps) (ycle 2) (a) onstruct a profile from the results of ycle 1. (b) Search the database using the profile. (ycle 3) (a) onstruct a profile from the results of ycle 2. (b) Search the database using the profile. And So On... (user sets the number of cycles) Psi-BLAST is much more sensitive than BLAST. Also more vulnerable to low-complexity.

23 PHI-BLAST -- Patterned Hit Initiated BLAST 23

24 DNA or Protein search? Advantages of searching DNA databases Larger database. Does not assume a reading frame. an find similarity in non-coding regions (introns, promotor regions). an find frameshift mutations. an find pseudogenes. Disadvantages Slower. Not as sensitive. Ignores selective pressure at the protein level. Advantages of searching protein sequences Faster. More sensitive. More biologically relevant. Disadvantages Not applicable to non-coding DNA (promotors, introns, etc)

25 Bioinformatics Sequence alignment Database searching Significance, e-values Trees ene ontology Protein Structure 25

26 How significant is that?...how likely the data would not have been the result of chance,... Please give me a number for......as opposed to......a specific inference. Thanks.

27 score Dayhoff's randomization experiment Aligned scrambled Protein A versus scrambled Protein B 100 times (re-scrambling each time). NOTE: scrambling does not change the AA composition! Results: A Normal Distribution freq significance of a score is measured as the probability of getting this score in a random alignment

28 Lippman's randomization experiment Aligned Protein A to 100 natural sequences, not scrambled. Results: A wider normal distribution (Std dev = ~3 times larger) WHY? Because natural sequences are different than random. Even unrelated sequences have similar local patterns, and uneven amino acid composition. freq Was the significance over-estimated using Dayhoff's method? score Lippman got a similar result if he randomized the sequences by words instead of letters.

29 P(S > x) E(M) gives us the expected length of the longest number of matches in a row. But, what we really want is the answer to this question: How good is the score x? (i.e. how significant) So, we need to model the whole distribution of chance scores, then ask how likely is it that my score or greater comes from that model. freq score

30 A normal distribution Suppose you had a aussian distribution dart-board. You throw 1000 darts randomly. Score your darts according the number on the X-axis where it lands. What is the probability distribution of scores? Answer:The same aussian distribution! (duh)

31 Extreme values from a normal distribution What if we throw 10 darts at a time and keep only the highest-scoring dart (extreme value)? What is the distribution of the extreme values?

32 The Extreme Value Distribution Normal distributions (Dayhoff, Lippman) overestimate significance when the scores are extreme values. EVD is the correct null model.

33 Fitting the EVD to random alignments Estimated P (integral of the EVD): P(S x) Kmne -λx where K=constant, m=size of database, n=length of sequence, λ=constant Taking the log, log(p(s x)) = log(kmn) - λx enerate a large number of known false alignment scores S, (all alignments with the same two lengths m and n), Plot log(p(s x)) versus x, fit to a line! logp(s x) x x x x x x The slope is λ, the intercept is log(kmn). Now we can calculate P for any score x. x x x x x x x xx x x x

34 Pop-quiz You did a BLAST search using a sequence that has absolutely no homologs in the database. Absolutely none. The BLAST search gave you false hits with the top e- values ranging from 0 to 20. You look at them and you notice a pattern in the e-values. How many of your hits have e-value 10.?

As of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be

As of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be 48 Bioinformatics I, WS 09-10, S. Henz (script by D. Huson) November 26, 2009 4 BLAST and BLAT Outline of the chapter: 1. Heuristics for the pairwise local alignment of two sequences 2. BLAST: search and

More information

Bioinformatics explained: BLAST. March 8, 2007

Bioinformatics explained: BLAST. March 8, 2007 Bioinformatics Explained Bioinformatics explained: BLAST March 8, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com Bioinformatics

More information

24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:

24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading: 24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid

More information

Sequence alignment theory and applications Session 3: BLAST algorithm

Sequence alignment theory and applications Session 3: BLAST algorithm Sequence alignment theory and applications Session 3: BLAST algorithm Introduction to Bioinformatics online course : IBT Sonal Henson Learning Objectives Understand the principles of the BLAST algorithm

More information

Database Searching Using BLAST

Database Searching Using BLAST Mahidol University Objectives SCMI512 Molecular Sequence Analysis Database Searching Using BLAST Lecture 2B After class, students should be able to: explain the FASTA algorithm for database searching explain

More information

BLAST MCDB 187. Friday, February 8, 13

BLAST MCDB 187. Friday, February 8, 13 BLAST MCDB 187 BLAST Basic Local Alignment Sequence Tool Uses shortcut to compute alignments of a sequence against a database very quickly Typically takes about a minute to align a sequence against a database

More information

CISC 636 Computational Biology & Bioinformatics (Fall 2016)

CISC 636 Computational Biology & Bioinformatics (Fall 2016) CISC 636 Computational Biology & Bioinformatics (Fall 2016) Sequence pairwise alignment Score statistics: E-value and p-value Heuristic algorithms: BLAST and FASTA Database search: gene finding and annotations

More information

Basic Local Alignment Search Tool (BLAST)

Basic Local Alignment Search Tool (BLAST) BLAST 26.04.2018 Basic Local Alignment Search Tool (BLAST) BLAST (Altshul-1990) is an heuristic Pairwise Alignment composed by six-steps that search for local similarities. The most used access point to

More information

BLAST - Basic Local Alignment Search Tool

BLAST - Basic Local Alignment Search Tool Lecture for ic Bioinformatics (DD2450) April 11, 2013 Searching 1. Input: Query Sequence 2. Database of sequences 3. Subject Sequence(s) 4. Output: High Segment Pairs (HSPs) Sequence Similarity Measures:

More information

Lecture 5 Advanced BLAST

Lecture 5 Advanced BLAST Introduction to Bioinformatics for Medical Research Gideon Greenspan gdg@cs.technion.ac.il Lecture 5 Advanced BLAST BLAST Recap Sequence Alignment Complexity and indexing BLASTN and BLASTP Basic parameters

More information

BLAST, Profile, and PSI-BLAST

BLAST, Profile, and PSI-BLAST BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources

More information

Bioinformatics for Biologists

Bioinformatics for Biologists Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover

More information

BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha

BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio. 1990. CS 466 Saurabh Sinha Motivation Sequence homology to a known protein suggest function of newly sequenced protein Bioinformatics

More information

Pairwise Sequence Alignment. Zhongming Zhao, PhD

Pairwise Sequence Alignment. Zhongming Zhao, PhD Pairwise Sequence Alignment Zhongming Zhao, PhD Email: zhongming.zhao@vanderbilt.edu http://bioinfo.mc.vanderbilt.edu/ Sequence Similarity match mismatch A T T A C G C G T A C C A T A T T A T G C G A T

More information

Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.

Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the

More information

B L A S T! BLAST: Basic local alignment search tool. Copyright notice. February 6, Pairwise alignment: key points. Outline of tonight s lecture

B L A S T! BLAST: Basic local alignment search tool. Copyright notice. February 6, Pairwise alignment: key points. Outline of tonight s lecture February 6, 2008 BLAST: Basic local alignment search tool B L A S T! Jonathan Pevsner, Ph.D. Introduction to Bioinformatics pevsner@jhmi.edu 4.633.0 Copyright notice Many of the images in this powerpoint

More information

FASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm.

FASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm. FASTA INTRODUCTION Definition (by David J. Lipman and William R. Pearson in 1985) - Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence

More information

Similarity Searches on Sequence Databases

Similarity Searches on Sequence Databases Similarity Searches on Sequence Databases Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Zürich, October 2004 Swiss Institute of Bioinformatics Swiss EMBnet node Outline Importance of

More information

CS313 Exercise 4 Cover Page Fall 2017

CS313 Exercise 4 Cover Page Fall 2017 CS313 Exercise 4 Cover Page Fall 2017 Due by the start of class on Thursday, October 12, 2017. Name(s): In the TIME column, please estimate the time you spent on the parts of this exercise. Please try

More information

BGGN 213 Foundations of Bioinformatics Barry Grant

BGGN 213 Foundations of Bioinformatics Barry Grant BGGN 213 Foundations of Bioinformatics Barry Grant http://thegrantlab.org/bggn213 Recap From Last Time: 25 Responses: https://tinyurl.com/bggn213-02-f17 Why ALIGNMENT FOUNDATIONS Why compare biological

More information

Computational Molecular Biology

Computational Molecular Biology Computational Molecular Biology Erwin M. Bakker Lecture 3, mainly from material by R. Shamir [2] and H.J. Hoogeboom [4]. 1 Pairwise Sequence Alignment Biological Motivation Algorithmic Aspect Recursive

More information

CS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores.

CS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores. CS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores. prepared by Oleksii Kuchaiev, based on presentation by Xiaohui Xie on February 20th. 1 Introduction

More information

An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST

An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise

More information

Introduction to Computational Molecular Biology

Introduction to Computational Molecular Biology 18.417 Introduction to Computational Molecular Biology Lecture 13: October 21, 2004 Scribe: Eitan Reich Lecturer: Ross Lippert Editor: Peter Lee 13.1 Introduction We have been looking at algorithms to

More information

.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar..

.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. .. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. PAM and BLOSUM Matrices Prepared by: Jason Banich and Chris Hoover Background As DNA sequences change and evolve, certain amino acids are more

More information

C E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 13 G R A T I V. Iterative homology searching,

C E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 13 G R A T I V. Iterative homology searching, C E N T R E F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U Introduction to bioinformatics 2007 Lecture 13 Iterative homology searching, PSI (Position Specific Iterated) BLAST basic idea use

More information

Biology 644: Bioinformatics

Biology 644: Bioinformatics Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find

More information

Wilson Leung 01/03/2018 An Introduction to NCBI BLAST. Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment

Wilson Leung 01/03/2018 An Introduction to NCBI BLAST. Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment An Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at https://blast.ncbi.nlm.nih.gov/blast.cgi

More information

Alignment of Pairs of Sequences

Alignment of Pairs of Sequences Bi03a_1 Unit 03a: Alignment of Pairs of Sequences Partners for alignment Bi03a_2 Protein 1 Protein 2 =amino-acid sequences (20 letter alphabeth + gap) LGPSSKQTGKGS-SRIWDN LN-ITKSAGKGAIMRLGDA -------TGKG--------

More information

Alignments BLAST, BLAT

Alignments BLAST, BLAT Alignments BLAST, BLAT Genome Genome Gene vs Built of DNA DNA Describes Organism Protein gene Stored as Circular/ linear Single molecule, or a few of them Both (depending on the species) Part of genome

More information

COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1. Database Searching

COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1. Database Searching COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1 Database Searching In database search, we typically have a large sequence database

More information

MetaPhyler Usage Manual

MetaPhyler Usage Manual MetaPhyler Usage Manual Bo Liu boliu@umiacs.umd.edu March 13, 2012 Contents 1 What is MetaPhyler 1 2 Installation 1 3 Quick Start 2 3.1 Taxonomic profiling for metagenomic sequences.............. 2 3.2

More information

Lecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:

Lecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations: Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating

More information

Sequence Alignment & Search

Sequence Alignment & Search Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version

More information

Chapter 4: Blast. Chaochun Wei Fall 2014

Chapter 4: Blast. Chaochun Wei Fall 2014 Course organization Introduction ( Week 1-2) Course introduction A brief introduction to molecular biology A brief introduction to sequence comparison Part I: Algorithms for Sequence Analysis (Week 3-11)

More information

CAP BLAST. BIOINFORMATICS Su-Shing Chen CISE. 8/20/2005 Su-Shing Chen, CISE 1

CAP BLAST. BIOINFORMATICS Su-Shing Chen CISE. 8/20/2005 Su-Shing Chen, CISE 1 CAP 5510-6 BLAST BIOINFORMATICS Su-Shing Chen CISE 8/20/2005 Su-Shing Chen, CISE 1 BLAST Basic Local Alignment Prof Search Su-Shing Chen Tool A Fast Pair-wise Alignment and Database Searching Tool 8/20/2005

More information

Heuristic methods for pairwise alignment:

Heuristic methods for pairwise alignment: Bi03c_1 Unit 03c: Heuristic methods for pairwise alignment: k-tuple-methods k-tuple-methods for alignment of pairs of sequences Bi03c_2 dynamic programming is too slow for large databases Use heuristic

More information

INTRODUCTION TO BIOINFORMATICS

INTRODUCTION TO BIOINFORMATICS Molecular Biology-2019 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain

More information

Scoring and heuristic methods for sequence alignment CG 17

Scoring and heuristic methods for sequence alignment CG 17 Scoring and heuristic methods for sequence alignment CG 17 Amino Acid Substitution Matrices Used to score alignments. Reflect evolution of sequences. Unitary Matrix: M ij = 1 i=j { 0 o/w Genetic Code Matrix:

More information

INTRODUCTION TO BIOINFORMATICS

INTRODUCTION TO BIOINFORMATICS Molecular Biology-2017 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain

More information

BLAST & Genome assembly

BLAST & Genome assembly BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies November 17, 2012 1 Introduction Introduction 2 BLAST What is BLAST? The algorithm 3 Genome assembly De

More information

2) NCBI BLAST tutorial This is a users guide written by the education department at NCBI.

2) NCBI BLAST tutorial   This is a users guide written by the education department at NCBI. Web resources -- Tour. page 1 of 8 This is a guided tour. Any homework is separate. In fact, this exercise is used for multiple classes and is publicly available to everyone. The entire tour will take

More information

Sequence analysis Pairwise sequence alignment

Sequence analysis Pairwise sequence alignment UMF11 Introduction to bioinformatics, 25 Sequence analysis Pairwise sequence alignment 1. Sequence alignment Lecturer: Marina lexandersson 12 September, 25 here are two types of sequence alignments, global

More information

Similarity searches in biological sequence databases

Similarity searches in biological sequence databases Similarity searches in biological sequence databases Volker Flegel september 2004 Page 1 Outline Keyword search in databases General concept Examples SRS Entrez Expasy Similarity searches in databases

More information

Sequence Alignment. GBIO0002 Archana Bhardwaj University of Liege

Sequence Alignment. GBIO0002 Archana Bhardwaj University of Liege Sequence Alignment GBIO0002 Archana Bhardwaj University of Liege 1 What is Sequence Alignment? A sequence alignment is a way of arranging the sequences of DNA, RNA, or protein to identify regions of similarity.

More information

BLAST & Genome assembly

BLAST & Genome assembly BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies May 15, 2014 1 BLAST What is BLAST? The algorithm 2 Genome assembly De novo assembly Mapping assembly 3

More information

Introduction to BLAST with Protein Sequences. Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2

Introduction to BLAST with Protein Sequences. Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2 Introduction to BLAST with Protein Sequences Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2 1 References Chapter 2 of Biological Sequence Analysis (Durbin et al., 2001)

More information

Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014

Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into

More information

VL Algorithmen und Datenstrukturen für Bioinformatik ( ) WS15/2016 Woche 9

VL Algorithmen und Datenstrukturen für Bioinformatik ( ) WS15/2016 Woche 9 VL Algorithmen und Datenstrukturen für Bioinformatik (19400001) WS15/2016 Woche 9 Tim Conrad AG Medical Bioinformatics Institut für Mathematik & Informatik, Freie Universität Berlin Contains material from

More information

Wilson Leung 05/27/2008 A Simple Introduction to NCBI BLAST

Wilson Leung 05/27/2008 A Simple Introduction to NCBI BLAST A Simple Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at http://www.ncbi.nih.gov/blast/

More information

Introduction to Phylogenetics Week 2. Databases and Sequence Formats

Introduction to Phylogenetics Week 2. Databases and Sequence Formats Introduction to Phylogenetics Week 2 Databases and Sequence Formats I. Databases Crucial to bioinformatics The bigger the database, the more comparative research data Requires scientists to upload data

More information

Sequence Alignment Heuristics

Sequence Alignment Heuristics Sequence Alignment Heuristics Some slides from: Iosif Vaisman, GMU mason.gmu.edu/~mmasso/binf630alignment.ppt Serafim Batzoglu, Stanford http://ai.stanford.edu/~serafim/ Geoffrey J. Barton, Oxford Protein

More information

Lecture 4: January 1, Biological Databases and Retrieval Systems

Lecture 4: January 1, Biological Databases and Retrieval Systems Algorithms for Molecular Biology Fall Semester, 1998 Lecture 4: January 1, 1999 Lecturer: Irit Orr Scribe: Irit Gat and Tal Kohen 4.1 Biological Databases and Retrieval Systems In recent years, biological

More information

Searching Sequence Databases

Searching Sequence Databases Wright State University CORE Scholar Computer Science and Engineering Faculty Publications Computer Science & Engineering 2003 Searching Sequence Databases Dan E. Krane Wright State University - Main Campus,

More information

Sequence Alignment (chapter 6) p The biological problem p Global alignment p Local alignment p Multiple alignment

Sequence Alignment (chapter 6) p The biological problem p Global alignment p Local alignment p Multiple alignment Sequence lignment (chapter 6) p The biological problem p lobal alignment p Local alignment p Multiple alignment Local alignment: rationale p Otherwise dissimilar proteins may have local regions of similarity

More information

Module: Sequence Alignment Theory and Applica8ons Session: BLAST

Module: Sequence Alignment Theory and Applica8ons Session: BLAST Module: Sequence Alignment Theory and Applica8ons Session: BLAST Learning Objec8ves and Outcomes v Understand the principles of the BLAST algorithm v Understand the different BLAST algorithms, parameters

More information

Database Similarity Searching

Database Similarity Searching An Introduction to Bioinformatics BSC4933/ISC5224 Florida State University Feb. 23, 2009 Database Similarity Searching Steven M. Thompson Florida State University of Department Scientific Computing How

More information

3.4 Multiple sequence alignment

3.4 Multiple sequence alignment 3.4 Multiple sequence alignment Why produce a multiple sequence alignment? Using more than two sequences results in a more convincing alignment by revealing conserved regions in ALL of the sequences Aligned

More information

ICB Fall G4120: Introduction to Computational Biology. Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology

ICB Fall G4120: Introduction to Computational Biology. Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology ICB Fall 2008 G4120: Computational Biology Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology Copyright 2008 Oliver Jovanovic, All Rights Reserved. The Digital Language of Computers

More information

Computational Genomics and Molecular Biology, Fall

Computational Genomics and Molecular Biology, Fall Computational Genomics and Molecular Biology, Fall 2015 1 Sequence Alignment Dannie Durand Pairwise Sequence Alignment The goal of pairwise sequence alignment is to establish a correspondence between the

More information

Global Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties

Global Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties Global Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties From LCS to Alignment: Change the Scoring The Longest Common Subsequence (LCS) problem the simplest form of sequence

More information

Sequence alignment algorithms

Sequence alignment algorithms Sequence alignment algorithms Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 23 rd 27 After this lecture, you can decide when to use local and global sequence alignments

More information

CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment

CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features

More information

BIOL 7020 Special Topics Cell/Molecular: Molecular Phylogenetics. Spring 2010 Section A

BIOL 7020 Special Topics Cell/Molecular: Molecular Phylogenetics. Spring 2010 Section A BIOL 7020 Special Topics Cell/Molecular: Molecular Phylogenetics. Spring 2010 Section A Steve Thompson: stthompson@valdosta.edu http://www.bioinfo4u.net 1 Similarity searching and homology First, just

More information

FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:

FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10: FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:56 4001 4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem

More information

FastA & the chaining problem

FastA & the chaining problem FastA & the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 1 Sources for this lecture: Lectures by Volker Heun, Daniel Huson and Knut Reinert,

More information

Bioinformatics explained: Smith-Waterman

Bioinformatics explained: Smith-Waterman Bioinformatics Explained Bioinformatics explained: Smith-Waterman May 1, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com

More information

Single Pass, BLAST-like, Approximate String Matching on FPGAs*

Single Pass, BLAST-like, Approximate String Matching on FPGAs* Single Pass, BLAST-like, Approximate String Matching on FPGAs* Martin Herbordt Josh Model Yongfeng Gu Bharat Sukhwani Tom VanCourt Computer Architecture and Automated Design Laboratory Department of Electrical

More information

Preliminary Syllabus. Genomics. Introduction & Genome Assembly Sequence Comparison Gene Modeling Gene Function Identification

Preliminary Syllabus. Genomics. Introduction & Genome Assembly Sequence Comparison Gene Modeling Gene Function Identification Preliminary Syllabus Sep 30 Oct 2 Oct 7 Oct 9 Oct 14 Oct 16 Oct 21 Oct 25 Oct 28 Nov 4 Nov 8 Introduction & Genome Assembly Sequence Comparison Gene Modeling Gene Function Identification OCTOBER BREAK

More information

Reconstructing long sequences from overlapping sequence fragment. Searching databases for related sequences and subsequences

Reconstructing long sequences from overlapping sequence fragment. Searching databases for related sequences and subsequences SEQUENCE ALIGNMENT ALGORITHMS 1 Why compare sequences? Reconstructing long sequences from overlapping sequence fragment Searching databases for related sequences and subsequences Storing, retrieving and

More information

L4: Blast: Alignment Scores etc.

L4: Blast: Alignment Scores etc. L4: Blast: Alignment Scores etc. Why is Blast Fast? Silly Question Prove or Disprove: There are two people in New York City with exactly the same number of hairs. Large database search Database (n) Query

More information

TCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology?

TCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology? Local Sequence Alignment & Heuristic Local Aligners Lectures 18 Nov 28, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall

More information

Homology Modeling FABP

Homology Modeling FABP Homology Modeling FABP Homology modeling is a technique used to approximate the 3D structure of a protein when no experimentally determined structure exists. It operates under the principle that protein

More information

Comparative Analysis of Protein Alignment Algorithms in Parallel environment using CUDA

Comparative Analysis of Protein Alignment Algorithms in Parallel environment using CUDA Comparative Analysis of Protein Alignment Algorithms in Parallel environment using BLAST versus Smith-Waterman Shadman Fahim shadmanbracu09@gmail.com Shehabul Hossain rudrozzal@gmail.com Gulshan Jubaed

More information

diamond v February 15, 2018

diamond v February 15, 2018 The DIAMOND protein aligner Introduction DIAMOND is a sequence aligner for protein and translated DNA searches, designed for high performance analysis of big sequence data. The key features are: Pairwise

More information

Bioinformatics Sequence comparison 2 local pairwise alignment

Bioinformatics Sequence comparison 2 local pairwise alignment Bioinformatics Sequence comparison 2 local pairwise alignment David Gilbert Bioinformatics Research Centre www.brc.dcs.gla.ac.uk Department of Computing Science, University of Glasgow Lecture contents

More information

Algorithms in Bioinformatics: A Practical Introduction. Database Search

Algorithms in Bioinformatics: A Practical Introduction. Database Search Algorithms in Bioinformatics: A Practical Introduction Database Search Biological databases Biological data is double in size every 15 or 16 months Increasing in number of queries: 40,000 queries per day

More information

Biology 644: Bioinformatics

Biology 644: Bioinformatics A statistical Markov model in which the system being modeled is assumed to be a Markov process with unobserved (hidden) states in the training data. First used in speech and handwriting recognition In

More information

From Smith-Waterman to BLAST

From Smith-Waterman to BLAST From Smith-Waterman to BLAST Jeremy Buhler July 23, 2015 Smith-Waterman is the fundamental tool that we use to decide how similar two sequences are. Isn t that all that BLAST does? In principle, it is

More information

JET 2 User Manual 1 INSTALLATION 2 EXECUTION AND FUNCTIONALITIES. 1.1 Download. 1.2 System requirements. 1.3 How to install JET 2

JET 2 User Manual 1 INSTALLATION 2 EXECUTION AND FUNCTIONALITIES. 1.1 Download. 1.2 System requirements. 1.3 How to install JET 2 JET 2 User Manual 1 INSTALLATION 1.1 Download The JET 2 package is available at www.lcqb.upmc.fr/jet2. 1.2 System requirements JET 2 runs on Linux or Mac OS X. The program requires some external tools

More information

Sequence Alignment: Mo1va1on and Algorithms. Lecture 2: August 23, 2012

Sequence Alignment: Mo1va1on and Algorithms. Lecture 2: August 23, 2012 Sequence Alignment: Mo1va1on and Algorithms Lecture 2: August 23, 2012 Mo1va1on and Introduc1on Importance of Sequence Alignment For DNA, RNA and amino acid sequences, high sequence similarity usually

More information

Finding Selection in All the Right Places TA Notes and Key Lab 9

Finding Selection in All the Right Places TA Notes and Key Lab 9 Objectives: Finding Selection in All the Right Places TA Notes and Key Lab 9 1. Use published genome data to look for evidence of selection in individual genes. 2. Understand the need for DNA sequence

More information

The Effect of Inverse Document Frequency Weights on Indexed Sequence Retrieval. Kevin C. O'Kane. Department of Computer Science

The Effect of Inverse Document Frequency Weights on Indexed Sequence Retrieval. Kevin C. O'Kane. Department of Computer Science The Effect of Inverse Document Frequency Weights on Indexed Sequence Retrieval Kevin C. O'Kane Department of Computer Science The University of Northern Iowa Cedar Falls, Iowa okane@cs.uni.edu http://www.cs.uni.edu/~okane

More information

BLAST Exercise 2: Using mrna and EST Evidence in Annotation Adapted by W. Leung and SCR Elgin from Annotation Using mrna and ESTs by Dr. J.

BLAST Exercise 2: Using mrna and EST Evidence in Annotation Adapted by W. Leung and SCR Elgin from Annotation Using mrna and ESTs by Dr. J. BLAST Exercise 2: Using mrna and EST Evidence in Annotation Adapted by W. Leung and SCR Elgin from Annotation Using mrna and ESTs by Dr. J. Buhler Prerequisites: BLAST Exercise: Detecting and Interpreting

More information

A Coprocessor Architecture for Fast Protein Structure Prediction

A Coprocessor Architecture for Fast Protein Structure Prediction A Coprocessor Architecture for Fast Protein Structure Prediction M. Marolia, R. Khoja, T. Acharya, C. Chakrabarti Department of Electrical Engineering Arizona State University, Tempe, USA. Abstract Predicting

More information

Multiple Sequence Alignment. Mark Whitsitt - NCSA

Multiple Sequence Alignment. Mark Whitsitt - NCSA Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV

More information

Tutorial 4 BLAST Searching the CHO Genome

Tutorial 4 BLAST Searching the CHO Genome Tutorial 4 BLAST Searching the CHO Genome Accessing the CHO Genome BLAST Tool The CHO BLAST server can be accessed by clicking on the BLAST button on the home page or by selecting BLAST from the menu bar

More information

Environmental Sample Classification E.S.C., Josh Katz and Kurt Zimmer

Environmental Sample Classification E.S.C., Josh Katz and Kurt Zimmer Environmental Sample Classification E.S.C., Josh Katz and Kurt Zimmer Goal: The task we were given for the bioinformatics capstone class was to construct an interface for the Pipas lab that integrated

More information

GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment

GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment Scoring Dynamic Programming algorithms Heuristic algorithms CLUSTAL W Courtesy of jalview Motivations Collective (or aggregate) statistic

More information

A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity

A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity G. Pratyusha, Department of Computer Science & Engineering, V.R.Siddhartha Engineering College(Autonomous)

More information

BLAST. NCBI BLAST Basic Local Alignment Search Tool

BLAST. NCBI BLAST Basic Local Alignment Search Tool BLAST NCBI BLAST Basic Local Alignment Search Tool http://www.ncbi.nlm.nih.gov/blast/ Global versus local alignments Global alignments: Attempt to align every residue in every sequence, Most useful when

More information

Principles of Bioinformatics. BIO540/STA569/CSI660 Fall 2010

Principles of Bioinformatics. BIO540/STA569/CSI660 Fall 2010 Principles of Bioinformatics BIO540/STA569/CSI660 Fall 2010 Lecture 11 Multiple Sequence Alignment I Administrivia Administrivia The midterm examination will be Monday, October 18 th, in class. Closed

More information

15-780: Graduate Artificial Intelligence. Computational biology: Sequence alignment and profile HMMs

15-780: Graduate Artificial Intelligence. Computational biology: Sequence alignment and profile HMMs 5-78: Graduate rtificial Intelligence omputational biology: Sequence alignment and profile HMMs entral dogma DN GGGG transcription mrn UGGUUUGUG translation Protein PEPIDE 2 omparison of Different Organisms

More information

How to Run NCBI BLAST on zcluster at GACRC

How to Run NCBI BLAST on zcluster at GACRC How to Run NCBI BLAST on zcluster at GACRC BLAST: Basic Local Alignment Search Tool Georgia Advanced Computing Resource Center University of Georgia Suchitra Pakala pakala@uga.edu 1 OVERVIEW What is BLAST?

More information

Lectures by Volker Heun, Daniel Huson and Knut Reinert, in particular last years lectures

Lectures by Volker Heun, Daniel Huson and Knut Reinert, in particular last years lectures 4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 4.1 Sources for this lecture Lectures by Volker Heun, Daniel Huson and Knut

More information

Lecture 2: Introduction to Computing September 29, 2014

Lecture 2: Introduction to Computing September 29, 2014 ICQB Introduction to Computational & Quantitative Biology (G4120) Fall 2014 Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology & Immunology Binary Computing and DNA Modern computers

More information

Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD

Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Assumptions: Biological sequences evolved by evolution. Micro scale changes: For short sequences (e.g. one

More information

How to use KAIKObase Version 3.1.0

How to use KAIKObase Version 3.1.0 How to use KAIKObase Version 3.1.0 Version3.1.0 29/Nov/2010 http://sgp2010.dna.affrc.go.jp/kaikobase/ Copyright National Institute of Agrobiological Sciences. All rights reserved. Outline 1. System overview

More information

Data Mining Technologies for Bioinformatics Sequences

Data Mining Technologies for Bioinformatics Sequences Data Mining Technologies for Bioinformatics Sequences Deepak Garg Computer Science and Engineering Department Thapar Institute of Engineering & Tecnology, Patiala Abstract Main tool used for sequence alignment

More information

COMPARATIVE MICROBIAL GENOMICS ANALYSIS WORKSHOP. Exercise 2: Predicting Protein-encoding Genes, BlastMatrix, BlastAtlas

COMPARATIVE MICROBIAL GENOMICS ANALYSIS WORKSHOP. Exercise 2: Predicting Protein-encoding Genes, BlastMatrix, BlastAtlas COMPARATIVE MICROBIAL GENOMICS ANALYSIS WORKSHOP Exercise 2: Predicting Protein-encoding Genes, BlastMatrix, BlastAtlas First of all connect once again to the CBS system: Open ssh shell client. Press Quick

More information