Module: Sequence Alignment Theory and Applica8ons Session: BLAST
|
|
- Mabel Armstrong
- 6 years ago
- Views:
Transcription
1 Module: Sequence Alignment Theory and Applica8ons Session: BLAST
2 Learning Objec8ves and Outcomes v Understand the principles of the BLAST algorithm v Understand the different BLAST algorithms, parameters and their applica:ons v Be able to adjust the sensi:vity and specificity of BLAST searches v Understand and evaluate BLAST results
3 Database Similarity Searching v A main applica:on of pairwise alignment is retrieving biological sequences in databases based on similarity v This process involves submission of a query sequence and performing a pairwise comparison of the query sequence with all individual sequences in a database
4 Database Similarity Searching v Database similarity searching is pairwise alignment on a large scale v Is one of the most effec:ve ways to assign puta:ve func:ons to newly determined sequences
5 DNA/Protein Search (1) v DNA is composed of 4 characters: A,G,C,T, at least 25% of the nucleotides of any 2 unrelated aligned sequences, would be identical v Protein sequence is composed of 20 a.a., the sensitivity of the comparison is improved v It is accepted that convergence of proteins is rare, meaning high similarity between 2 proteins always means homology
6 DNA / Protein search (2) v When comparing DNA sequences, we get significantly more random matches than we get with proteins v The DNA databases are much larger, and grow faster than protein databases v Bigger database means more random hits v For DNA we usually use identity matrices, for protein more sensitive matrices like PAM and BLOSUM allow for better search results
7 Database Search Requirements (1) v Requirements for implemen:ng algorithms for sequence database searching v Sensi:vity refers to the ability to find as many correct hits as possible v It is measured by the extent of inclusion of correctly iden:fied sequence members of the same family v These correct hits are considered true posi:ves in the database searching exercise
8 Database Search Requirements (2) v The second criterion is selec%vity, also called Specificity v Refers to the ability to exclude incorrect hits v These incorrect hits are unrelated sequences mistakenly iden:fied in database searching and are considered false posi:ves v The third criterion is speed, which is the :me it takes to get results from database searches v Depending on the size of the database, speed some:mes can be a primary concern
9 Database Search Requirements (3) v Ideally, one wants to have the greatest sensi:vity, selec:vity, and speed in database searches v However, sa:sfying all three requirements is difficult in reality v What generally happens is that an increase in sensitivity is associated with decrease in selectivity
10 Database Search Requirements (5) v A very inclusive search tends to include many false posi:ves v Similarly, an improvement in speed omen comes at the cost of lowered sensi:vity and selec:vity v A compromise between the three criteria omen has to be made
11 Heuris8c Database Searching (1) v Two major heuris:c algorithms for performing database searches - BLAST and FASTA v These methods are not guaranteed to find the op:mal alignment or true homologous, but are :mes faster than dynamic programming v Programs can provide a reasonably good indica:on of sequence similarity by iden:fying similar sequence segments
12 Heuris8c Database Searching (2) v Both BLAST and FASTA use a heuris:c word method for fast pairwise sequence alignment v It works by finding short stretches of iden:cal or nearly iden:cal leuers in two sequences v These short stretches of characters are called words v The basic assump:on is that two related sequences must have at least one word in common
13 v First iden:fying word matches, a longer alignment can be obtained by extending similarity regions from the words
14 BLAST v BLAST Basic Local Alignment Search Tool v Is an approximate algorithm v Finds the highest scoring local op:mal alignment between query sequence and a database of sequences v To discover all of the similar sequences in the database v Create a sta:s:cal interpreta:on to enable the user dis:nguish a par:cular DNA or protein
15 BLAST (2) v The sequence you give to blast is the query sequence v Sequences similar to the query that blast returns are the hits or matches v The database you search is the target database
16 v One innova:on introduced in BLAST is the idea of neighborhood words v Instead of requiring words to match exactly, a word hit is achieved if the word taken from the subject sequence has a score of at least T when a comparison is made using a subs:tu:on matrix to the word from the query v This strategy allows the word size (W) to be kept high (for speed) without sacrificing sensi:vity
17 v The first step is to create a list of words from the query sequence v Each word is typically three residues for protein sequences and eleven residues for DNA sequences
18 1. Query sequence: AFRICANISED 2. Scan every 3 residues to be used in searching BLAST word database 3. Finds matches in the database Query CAN CAN CAN CAN CAN Database CTN CAN CWN CAY CCSA 4. Calculate sums of match scores based on BLOSUM62 matrix Query CAN CAN CAN CAN CAN Database CTN CAN CWT CAY CSA Sum of score Sequence Alignment Theory and Applica8ons, Pandam
19 5. Find the database sequence corresponding to the best word match and extend alignment in both direc:ons Query A F R I C A N I S E D Database A G R I C A N I T E D 6. Determine high scored segment above threshold Query A F R I C A N I S E D Database A G R I C A N I T E D High Scoring segment pair, total score 42
20 v The extension con:nues un:l the score of the alignment drops below a threshold due to mismatches Proteins = 22 DNA = 20
21 Types of BLAST v There are several variants of BLAST, each dis:nguished by the type of sequence (DNA or protein) of the query and database sequences v BLASTP program compares a protein query to a protein database v BLASTX compares a DNA query sequence to the protein database, which is useful for analyzing new sequence data and ESTs v TBLASTN for a protein query against a nucleo:de database v TBLASTX takes DNA query and database sequences, translates them both, and compares them as protein sequences
22 Sequence Databases Used With BLAST v Nr - database provides comprehensive collec:ons of both amino acid and nucleo:de sequence data, with redundancy reduced by merging sequences that are completely iden:cal v Swissprot The SWISS- PROT database v 16S ribosomal RNA sequences v Transcriptome shortgun assembly v Human RefSeqGene sequences
23 Database Searching Ar8facts v A query sequence that contains repe::ve elements is likely to produce many false and confounding database matches v Likely ar:facts would be finding hits to many proteins that seem to have no func:onal rela:onship to one another or hits to genomic sequences from many different chromosomes v Both the query and the database are contaminated with foreign sequences from the same source, for instance, cloning vectors
24 Database Searching Ar8facts (2) v It is always good prac:ce to cri:cally evaluate database search results and be suspicious of ar:facts when the data don t make sense v A more proac:ve approach involves masking problema:c sequences in the query before doing the search v Both proteins and nucleic acids contain regions of biased composi:on, which can lead to confusing database search results
25 Low- Complexity Regions (LCRs) v In both protein and DNA sequences, there may be regions that contain highly repe::ve residues v Es:mates indicate that LCRs account for about 15% of the total protein sequences in public databases v These elements in query sequences can cause spurious database matches and lead to ar:ficially high alignment scores with unrelated sequences
26 LCRs (1) v Alignment of LCR- containing sequences is problema:c because they do not fit the model of residue- by- residue sequence conserva:on v Methods for assessing the sta:s:cal significance of alignments are based on certain no:ons of randomness which LCRs do not obey
27 LCRs (2) v The evolu:onary, func:onal, and structural proper:es of LCRs are not well understood v LCRs arise by such mechanisms as v polymerase slippage v biased nucleo:de subs:tu:on v unequal crossing- over v In proteins, LCRs are likely to exist structurally as nonglobular regions v Regions that have been defined physico- chemically as nonglobular
28 Masking of LRCs (1) v To avoid the problem of high similarity scores owing to matching of LCRs that obscure the real similari:es v It is important to filter out the problema:c regions in both the query and database sequences to improve the signal- to- noise ra:o v = Masking v Two types, hard masking and som masking
29 Masking of LRCs (2) v Hard masking involves replacing LCR sequences with an ambiguity character such as N for v Nucleo:de residues or X for amino acid residues v The drawback is that matching scores with true homologs may be lowered because of shortened alignments v So4 masking involves conver:ng the problema:c sequences to lower case leuers, which are ignored in construc:ng the word dic:onary v But are used in word extension and op:miza:on of alignments
30 BLAST Programs
31 BLAST Suite
32 BLAST Search Op8misa8ons
33 BLAST Search Op8misa8ons
34 BLAST OUTPUT v The graphical output includes coloured horizontal bars and a diagonal in a two- dimensional diagram showing the overall extent of matching between the two sequences v The colour coding of the horizontal bars corresponds to the ranking of similari:es of the sequence hits v Red = most related; Green and Blue = moderately related and Black = unrelated
35 Graphical Report
36 BLAST Output v The list of hits v Database accession codes, name, description, general information about the hit v Score in bits, the alignment score expressed in units of information v Usually 30 bits are required for significance
37 v Expectation value E(), how many hits we expect to find by chance with this score, when comparing this query to the database v It is important to keep in mind that the E() value does not represent a measure of similarity between the two sequences.
38 Hits
39 Pairwise Alignment
40 Lineage Report
41 Taxonomic Report
42 Mul8- Alignment
43 Graphical Report
44 Conserved Domains Database
45
46
47 Smart BLAST
48 Sta8s8cal Significance v The significance scores help to dis:nguish evolu:onarily related sequences from unrelated ones v The larger the database, the more unrelated sequence alignments there are v E- value (E) indicates the probability that the resul:ng alignments from a database search are caused by random chance
49 E- Value E = m x n x P v Where ² m = the total number of residues in a database, ² n = the number of residues in the query sequence, and ² p = the probability that an HSP alignment is a result of random chance
50 Example 1 v Find an E- value for aligning a query sequence of 100 residues to a database containing a total of residues results in a P- value for the ungapped HSP region in one of the database matches of 10 20
51 Answer for Example 1 E = m x n x P v E = 100 x x = 10-3 v E = 1e- 3 in BLAST output v The E- value provides informa:on about the likelihood that a given sequence match is purely by chance
52 Significance of E- value (1) v The lower the E- value, the less likely the database match is a result of random chance v E < 1e 50 (or 1 x ), there should be an extremely high confidence that the database match is a result of homologous rela:onships v E is between 0.01 and 1e 50, the match can be considered a result of homology v E between 0.01 and 10, the match is considered not significant, but may hint at a tenta:ve remote homology rela:onship
53 Significance of E- value (2) v E > 10, the sequences under considera:on are either unrelated or related by extremely distant rela:onships that fall below the limit of detec:on with the current method
54 Think! EEEEEEE!!!! v E = m x n x p v E m, i.e. E- value is propor:onally affected by the database size v The problem is that as the database grows, the E- value for a given sequence match also increases
55 Weakness of E- value v The genuine evolu:onary rela:onship between the two sequences remains constant v The decrease in credibility of the sequence match as the database grows v Means that one may lose previously detected homologous as the database enlarges v Thus, an alterna:ve to E- value calcula:ons is needed
56 Bit Score v Is another prominent sta:s:cal indicator used in addi:on to the E- value in a BLAST output v The bit score measures sequence similarity independent of query sequence length and database size and is normalized based on the raw pairwise alignment score v S = (λ x S lnk)/ ln2 v Where λ is the Gumble distribu:on constant S is the raw alignment score, and K is a constant associated with the scoring matrix used
57 Bit Score v Clearly, the bit score (S ) is linearly related to the raw alignment score (S) v Thus, the higher the bit score, the more highly significant the match is v The bit score provides a constant sta:s:cal indicator for searching different databases of different sizes or for searching the same database at different :mes as the database enlarges
58 Posi8on- Specific Scoring Matrices (PSSM) v In a standard subs:tu:on matrix, such as BLOSUM62 the subs:tu:on of one amino acid with another is associated with a single score v An obvious simplifica:on given that the same amino acid may have different conserva:on pauerns in one context than another in accordance with differing roles in biological func:on
59 PSSM v Database searches can be tailored to find specific proteins families or domains through the use of subs:tu:on scores that reflect the subs:tu:on frequencies of each individual amino acid posi:on in a domain v In its simplest form, a PSSM consists of a set of 20 subs:tu:on scores at each posi:on along the mo:f one for each of the amino acids v It is also possible to assign scores to inser:ons and dele:ons in a posi:on- specific manner
60 PSSM v A commonly used somware package, HMMER (Eddy et al., 1995), contains a set of related programs for construc:ng and using PSSMs v Given a mul:ple alignment of several related proteins (e.g., one made using CLUSTAL W), the hmmbuild program may be used to calculate the posi:on- specific scores and save it to a file (HMM file format).
61 HMM v Using the hmmsearch program, the HMM file may be used as a query against a sequence database v hmmpfam is used to compare a single query sequence against a database of PSSMs (HMMs) v The power of PSSMs in database searches can be further enhanced by itera:ve approaches in which the highest scoring matches in one search are incorporated into a PSSM used in successive searches
62 Posi:on- Specific Iterated BLAST (PSI- BLAST) v Provides an automated facility for construc:ng refining, and searching PSSMs within the context of a single program v Star:ng with a query sequence provided by the user, the process begins with a standard BLASTP search of a sequence database v Highly significant alignments found in this search are then used to construct a PSSM on- the- fly
63 PSI- BLAST v Comparisons of the PSSM against the sequence database are performed using a varia:on of the word- based BLAST algorithm used for standard sequence comparisons v The process con:nues un:l no new matches are found or a specified limit on number of itera:ons is reached
64 GAP- BLAST v Use two hit approach v Word can be followed by a second word within a certain gap threshold v Matches are extended in both direc:on using a matrix in both direc:ons un:l the scores drops v Weakness performs dynamic programming at the end v The best alignment may be lie outside of the range it has defined
65 Other Specialised BLASTs
66 CONCLUSIONS v Sequence alignment and database searching are performed tens of thousands of :mes per day by scien:sts around the world and represent cri:cal techniques that all molecular biologists should be familiar with v Described some of the fundamental concepts involved basic understanding of how the programs work so that parameters can be intelligently selected
67 CONCLUSIONS v Aware of poten:al ar:facts and know how to avoid them v Important to apply the same powers of observa:on and cri:cal evalua:on that are used with any experimental method
Sequence alignment theory and applications Session 3: BLAST algorithm
Sequence alignment theory and applications Session 3: BLAST algorithm Introduction to Bioinformatics online course : IBT Sonal Henson Learning Objectives Understand the principles of the BLAST algorithm
More informationDatabase Searching Using BLAST
Mahidol University Objectives SCMI512 Molecular Sequence Analysis Database Searching Using BLAST Lecture 2B After class, students should be able to: explain the FASTA algorithm for database searching explain
More informationLecture 5 Advanced BLAST
Introduction to Bioinformatics for Medical Research Gideon Greenspan gdg@cs.technion.ac.il Lecture 5 Advanced BLAST BLAST Recap Sequence Alignment Complexity and indexing BLASTN and BLASTP Basic parameters
More information24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:
24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid
More informationDatabase Similarity Searching
Database Similarity Searching Why search databases? To find out if a new DNA sequence shares similari?es with sequences already deposited in the databanks. To find proteins homologous to a puta?ve coding
More informationSequence Alignment: Mo1va1on and Algorithms. Lecture 2: August 23, 2012
Sequence Alignment: Mo1va1on and Algorithms Lecture 2: August 23, 2012 Mo1va1on and Introduc1on Importance of Sequence Alignment For DNA, RNA and amino acid sequences, high sequence similarity usually
More informationAs of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be
48 Bioinformatics I, WS 09-10, S. Henz (script by D. Huson) November 26, 2009 4 BLAST and BLAT Outline of the chapter: 1. Heuristics for the pairwise local alignment of two sequences 2. BLAST: search and
More informationBLAST, Profile, and PSI-BLAST
BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources
More informationBLAST - Basic Local Alignment Search Tool
Lecture for ic Bioinformatics (DD2450) April 11, 2013 Searching 1. Input: Query Sequence 2. Database of sequences 3. Subject Sequence(s) 4. Output: High Segment Pairs (HSPs) Sequence Similarity Measures:
More informationSequence Alignment: Mo1va1on and Algorithms
Sequence Alignment: Mo1va1on and Algorithms Mo1va1on and Introduc1on Importance of Sequence Alignment For DNA, RNA and amino acid sequences, high sequence similarity usually implies significant func1onal
More informationBasic Local Alignment Search Tool (BLAST)
BLAST 26.04.2018 Basic Local Alignment Search Tool (BLAST) BLAST (Altshul-1990) is an heuristic Pairwise Alignment composed by six-steps that search for local similarities. The most used access point to
More informationC E N T R. Introduction to bioinformatics 2007 E B I O I N F O R M A T I C S V U F O R I N T. Lecture 13 G R A T I V. Iterative homology searching,
C E N T R E F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U Introduction to bioinformatics 2007 Lecture 13 Iterative homology searching, PSI (Position Specific Iterated) BLAST basic idea use
More informationBLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha
BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio. 1990. CS 466 Saurabh Sinha Motivation Sequence homology to a known protein suggest function of newly sequenced protein Bioinformatics
More informationBasics on bioinforma-cs Lecture 4. Concita Cantarella
Basics on bioinforma-cs Lecture 4 Concita Cantarella concita.cantarella@entecra.it; concita.cantarella@gmail.com Why compare sequences Sequence comparison is a way of arranging the sequences of DNA, RNA
More informationSearch Engines. Informa1on Retrieval in Prac1ce. Annota1ons by Michael L. Nelson
Search Engines Informa1on Retrieval in Prac1ce Annota1ons by Michael L. Nelson All slides Addison Wesley, 2008 Evalua1on Evalua1on is key to building effec$ve and efficient search engines measurement usually
More informationBioinformatics. Sequence alignment BLAST Significance. Next time Protein Structure
Bioinformatics Sequence alignment BLAST Significance Next time Protein Structure 1 Experimental origins of sequence data The Sanger dideoxynucleotide method F Each color is one lane of an electrophoresis
More informationCS313 Exercise 4 Cover Page Fall 2017
CS313 Exercise 4 Cover Page Fall 2017 Due by the start of class on Thursday, October 12, 2017. Name(s): In the TIME column, please estimate the time you spent on the parts of this exercise. Please try
More informationSimilarity Searches on Sequence Databases
Similarity Searches on Sequence Databases Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Zürich, October 2004 Swiss Institute of Bioinformatics Swiss EMBnet node Outline Importance of
More informationBioinformatics explained: BLAST. March 8, 2007
Bioinformatics Explained Bioinformatics explained: BLAST March 8, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com Bioinformatics
More informationAn Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST
An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise
More informationCAP BLAST. BIOINFORMATICS Su-Shing Chen CISE. 8/20/2005 Su-Shing Chen, CISE 1
CAP 5510-6 BLAST BIOINFORMATICS Su-Shing Chen CISE 8/20/2005 Su-Shing Chen, CISE 1 BLAST Basic Local Alignment Prof Search Su-Shing Chen Tool A Fast Pair-wise Alignment and Database Searching Tool 8/20/2005
More informationFASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm.
FASTA INTRODUCTION Definition (by David J. Lipman and William R. Pearson in 1985) - Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence
More informationCompares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.
Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the
More informationB L A S T! BLAST: Basic local alignment search tool. Copyright notice. February 6, Pairwise alignment: key points. Outline of tonight s lecture
February 6, 2008 BLAST: Basic local alignment search tool B L A S T! Jonathan Pevsner, Ph.D. Introduction to Bioinformatics pevsner@jhmi.edu 4.633.0 Copyright notice Many of the images in this powerpoint
More informationBiology 644: Bioinformatics
Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find
More informationHeuristic methods for pairwise alignment:
Bi03c_1 Unit 03c: Heuristic methods for pairwise alignment: k-tuple-methods k-tuple-methods for alignment of pairs of sequences Bi03c_2 dynamic programming is too slow for large databases Use heuristic
More informationCOS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1. Database Searching
COS 551: Introduction to Computational Molecular Biology Lecture: Oct 17, 2000 Lecturer: Mona Singh Scribe: Jacob Brenner 1 Database Searching In database search, we typically have a large sequence database
More informationPrinciples of Bioinformatics. BIO540/STA569/CSI660 Fall 2010
Principles of Bioinformatics BIO540/STA569/CSI660 Fall 2010 Lecture 11 Multiple Sequence Alignment I Administrivia Administrivia The midterm examination will be Monday, October 18 th, in class. Closed
More informationBioinformatics for Biologists
Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover
More informationBLAST Exercise 2: Using mrna and EST Evidence in Annotation Adapted by W. Leung and SCR Elgin from Annotation Using mrna and ESTs by Dr. J.
BLAST Exercise 2: Using mrna and EST Evidence in Annotation Adapted by W. Leung and SCR Elgin from Annotation Using mrna and ESTs by Dr. J. Buhler Prerequisites: BLAST Exercise: Detecting and Interpreting
More informationComputational Molecular Biology
Computational Molecular Biology Erwin M. Bakker Lecture 3, mainly from material by R. Shamir [2] and H.J. Hoogeboom [4]. 1 Pairwise Sequence Alignment Biological Motivation Algorithmic Aspect Recursive
More informationPPI Network Alignment Advanced Topics in Computa8onal Genomics
PPI Network Alignment 02-715 Advanced Topics in Computa8onal Genomics PPI Network Alignment Compara8ve analysis of PPI networks across different species by aligning the PPI networks Find func8onal orthologs
More informationBLAST MCDB 187. Friday, February 8, 13
BLAST MCDB 187 BLAST Basic Local Alignment Sequence Tool Uses shortcut to compute alignments of a sequence against a database very quickly Typically takes about a minute to align a sequence against a database
More informationCISC 636 Computational Biology & Bioinformatics (Fall 2016)
CISC 636 Computational Biology & Bioinformatics (Fall 2016) Sequence pairwise alignment Score statistics: E-value and p-value Heuristic algorithms: BLAST and FASTA Database search: gene finding and annotations
More informationInforma(on Retrieval
Introduc)on to Informa)on Retrieval CS3245 Informa(on Retrieval Lecture 7: Scoring, Term Weigh9ng and the Vector Space Model 7 Last Time: Index Compression Collec9on and vocabulary sta9s9cs: Heaps and
More informationComputational Genomics and Molecular Biology, Fall
Computational Genomics and Molecular Biology, Fall 2015 1 Sequence Alignment Dannie Durand Pairwise Sequence Alignment The goal of pairwise sequence alignment is to establish a correspondence between the
More informationAlignments BLAST, BLAT
Alignments BLAST, BLAT Genome Genome Gene vs Built of DNA DNA Describes Organism Protein gene Stored as Circular/ linear Single molecule, or a few of them Both (depending on the species) Part of genome
More informationInforma(on Retrieval
Introduc)on to Informa)on Retrieval CS3245 Informa(on Retrieval Lecture 7: Scoring, Term Weigh9ng and the Vector Space Model 7 Last Time: Index Construc9on Sort- based indexing Blocked Sort- Based Indexing
More informationCSCI 599 Class Presenta/on. Zach Levine. Markov Chain Monte Carlo (MCMC) HMM Parameter Es/mates
CSCI 599 Class Presenta/on Zach Levine Markov Chain Monte Carlo (MCMC) HMM Parameter Es/mates April 26 th, 2012 Topics Covered in this Presenta2on A (Brief) Review of HMMs HMM Parameter Learning Expecta2on-
More informationSearching Sequence Databases
Wright State University CORE Scholar Computer Science and Engineering Faculty Publications Computer Science & Engineering 2003 Searching Sequence Databases Dan E. Krane Wright State University - Main Campus,
More informationIntroduction to BLAST with Protein Sequences. Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2
Introduction to BLAST with Protein Sequences Utah State University Spring 2014 STAT 5570: Statistical Bioinformatics Notes 6.2 1 References Chapter 2 of Biological Sequence Analysis (Durbin et al., 2001)
More informationMultiple Sequence Alignment. Mark Whitsitt - NCSA
Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV
More informationBIOL591: Introduction to Bioinformatics Alignment of pairs of sequences
BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences Reading in text (Mount Bioinformatics): I must confess that the treatment in Mount of sequence alignment does not seem to me a model
More informationBLAST. NCBI BLAST Basic Local Alignment Search Tool
BLAST NCBI BLAST Basic Local Alignment Search Tool http://www.ncbi.nlm.nih.gov/blast/ Global versus local alignments Global alignments: Attempt to align every residue in every sequence, Most useful when
More informationAr#ficial Intelligence
Ar#ficial Intelligence Advanced Searching Prof Alexiei Dingli Gene#c Algorithms Charles Darwin Genetic Algorithms are good at taking large, potentially huge search spaces and navigating them, looking for
More informationBGGN 213 Foundations of Bioinformatics Barry Grant
BGGN 213 Foundations of Bioinformatics Barry Grant http://thegrantlab.org/bggn213 Recap From Last Time: 25 Responses: https://tinyurl.com/bggn213-02-f17 Why ALIGNMENT FOUNDATIONS Why compare biological
More informationWilson Leung 05/27/2008 A Simple Introduction to NCBI BLAST
A Simple Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at http://www.ncbi.nih.gov/blast/
More informationPreliminary Syllabus. Genomics. Introduction & Genome Assembly Sequence Comparison Gene Modeling Gene Function Identification
Preliminary Syllabus Sep 30 Oct 2 Oct 7 Oct 9 Oct 14 Oct 16 Oct 21 Oct 25 Oct 28 Nov 4 Nov 8 Introduction & Genome Assembly Sequence Comparison Gene Modeling Gene Function Identification OCTOBER BREAK
More informationSequence analysis Pairwise sequence alignment
UMF11 Introduction to bioinformatics, 25 Sequence analysis Pairwise sequence alignment 1. Sequence alignment Lecturer: Marina lexandersson 12 September, 25 here are two types of sequence alignments, global
More informationIntroduction to Phylogenetics Week 2. Databases and Sequence Formats
Introduction to Phylogenetics Week 2 Databases and Sequence Formats I. Databases Crucial to bioinformatics The bigger the database, the more comparative research data Requires scientists to upload data
More informationPROTEIN MULTIPLE ALIGNMENT MOTIVATION: BACKGROUND: Marina Sirota
Marina Sirota MOTIVATION: PROTEIN MULTIPLE ALIGNMENT To study evolution on the genetic level across a wide range of organisms, biologists need accurate tools for multiple sequence alignment of protein
More informationIntroduction to Computational Molecular Biology
18.417 Introduction to Computational Molecular Biology Lecture 13: October 21, 2004 Scribe: Eitan Reich Lecturer: Ross Lippert Editor: Peter Lee 13.1 Introduction We have been looking at algorithms to
More informationWilson Leung 01/03/2018 An Introduction to NCBI BLAST. Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment
An Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at https://blast.ncbi.nlm.nih.gov/blast.cgi
More informationCS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores.
CS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores. prepared by Oleksii Kuchaiev, based on presentation by Xiaohui Xie on February 20th. 1 Introduction
More informationLecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:
Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating
More informationINTRODUCTION TO BIOINFORMATICS
Molecular Biology-2017 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain
More information.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar..
.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. PAM and BLOSUM Matrices Prepared by: Jason Banich and Chris Hoover Background As DNA sequences change and evolve, certain amino acids are more
More informationFinding data. HMMER Answer key
Finding data HMMER Answer key HMMER input is prepared using VectorBase ClustalW, which runs a Java application for the graphical representation of the results. If you get an error message that blocks this
More informationLecture 4: January 1, Biological Databases and Retrieval Systems
Algorithms for Molecular Biology Fall Semester, 1998 Lecture 4: January 1, 1999 Lecturer: Irit Orr Scribe: Irit Gat and Tal Kohen 4.1 Biological Databases and Retrieval Systems In recent years, biological
More informationSequence Alignment & Search
Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version
More informationBioinformatics explained: Smith-Waterman
Bioinformatics Explained Bioinformatics explained: Smith-Waterman May 1, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com
More informationSearch Engines. Informa1on Retrieval in Prac1ce. Annotations by Michael L. Nelson
Search Engines Informa1on Retrieval in Prac1ce Annotations by Michael L. Nelson All slides Addison Wesley, 2008 Indexes Indexes are data structures designed to make search faster Text search has unique
More informationINTRODUCTION TO BIOINFORMATICS
Molecular Biology-2019 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain
More informationCS6200 Informa.on Retrieval. David Smith College of Computer and Informa.on Science Northeastern University
CS6200 Informa.on Retrieval David Smith College of Computer and Informa.on Science Northeastern University Indexing Process Indexes Indexes are data structures designed to make search faster Text search
More informationTutorial 4 BLAST Searching the CHO Genome
Tutorial 4 BLAST Searching the CHO Genome Accessing the CHO Genome BLAST Tool The CHO BLAST server can be accessed by clicking on the BLAST button on the home page or by selecting BLAST from the menu bar
More informationFrom Smith-Waterman to BLAST
From Smith-Waterman to BLAST Jeremy Buhler July 23, 2015 Smith-Waterman is the fundamental tool that we use to decide how similar two sequences are. Isn t that all that BLAST does? In principle, it is
More informationToday s Lecture. Multiple sequence alignment. Improved scoring of pairwise alignments. Affine gap penalties Profiles
Today s Lecture Multiple sequence alignment Improved scoring of pairwise alignments Affine gap penalties Profiles 1 The Edit Graph for a Pair of Sequences G A C G T T G A A T G A C C C A C A T G A C G
More informationProfiles and Multiple Alignments. COMP 571 Luay Nakhleh, Rice University
Profiles and Multiple Alignments COMP 571 Luay Nakhleh, Rice University Outline Profiles and sequence logos Profile hidden Markov models Aligning profiles Multiple sequence alignment by gradual sequence
More informationPairwise Sequence Alignment. Zhongming Zhao, PhD
Pairwise Sequence Alignment Zhongming Zhao, PhD Email: zhongming.zhao@vanderbilt.edu http://bioinfo.mc.vanderbilt.edu/ Sequence Similarity match mismatch A T T A C G C G T A C C A T A T T A T G C G A T
More informationChapter 4: Blast. Chaochun Wei Fall 2014
Course organization Introduction ( Week 1-2) Course introduction A brief introduction to molecular biology A brief introduction to sequence comparison Part I: Algorithms for Sequence Analysis (Week 3-11)
More informationBLAST & Genome assembly
BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies November 17, 2012 1 Introduction Introduction 2 BLAST What is BLAST? The algorithm 3 Genome assembly De
More informationSimilarity searches in biological sequence databases
Similarity searches in biological sequence databases Volker Flegel september 2004 Page 1 Outline Keyword search in databases General concept Examples SRS Entrez Expasy Similarity searches in databases
More informationLab 4: Multiple Sequence Alignment (MSA)
Lab 4: Multiple Sequence Alignment (MSA) The objective of this lab is to become familiar with the features of several multiple alignment and visualization tools, including the data input and output, basic
More informationScoring and heuristic methods for sequence alignment CG 17
Scoring and heuristic methods for sequence alignment CG 17 Amino Acid Substitution Matrices Used to score alignments. Reflect evolution of sequences. Unitary Matrix: M ij = 1 i=j { 0 o/w Genetic Code Matrix:
More informationData Mining Technologies for Bioinformatics Sequences
Data Mining Technologies for Bioinformatics Sequences Deepak Garg Computer Science and Engineering Department Thapar Institute of Engineering & Tecnology, Patiala Abstract Main tool used for sequence alignment
More informationBLAST & Genome assembly
BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies May 15, 2014 1 BLAST What is BLAST? The algorithm 2 Genome assembly De novo assembly Mapping assembly 3
More informationLecture 2. White- box Tes2ng and Structural Coverage (see Amman and Offut, Chapter 2)
Lecture 2 White- box Tes2ng and Structural Coverage (see Amman and Offut, Chapter 2) White- box Tes2ng (aka. Glass- box or structural tes2ng) An error may exist at one (or more) loca2on(s) Line numbers
More informationMultiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences
Multiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences Yue Lu and Sing-Hoi Sze RECOMB 2007 Presented by: Wanxing Xu March 6, 2008 Content Biology Motivation Computation Problem
More information2) NCBI BLAST tutorial This is a users guide written by the education department at NCBI.
Web resources -- Tour. page 1 of 8 This is a guided tour. Any homework is separate. In fact, this exercise is used for multiple classes and is publicly available to everyone. The entire tour will take
More informationBLAST. Basic Local Alignment Search Tool. Used to quickly compare a protein or DNA sequence to a database.
BLAST Basic Local Alignment Search Tool Used to quickly compare a protein or DNA sequence to a database. There is no such thing as a free lunch BLAST is fast and highly sensitive compared to competitors.
More informationDeformable Part Models
Deformable Part Models References: Felzenszwalb, Girshick, McAllester and Ramanan, Object Detec@on with Discrimina@vely Trained Part Based Models, PAMI 2010 Code available at hkp://www.cs.berkeley.edu/~rbg/latent/
More informationSequence Alignment. GBIO0002 Archana Bhardwaj University of Liege
Sequence Alignment GBIO0002 Archana Bhardwaj University of Liege 1 What is Sequence Alignment? A sequence alignment is a way of arranging the sequences of DNA, RNA, or protein to identify regions of similarity.
More informationWhen we search a nucleic acid databases, there is no need for you to carry out your own six frame translation. Mascot always performs a 6 frame
1 When we search a nucleic acid databases, there is no need for you to carry out your own six frame translation. Mascot always performs a 6 frame translation on the fly. That is, 3 reading frames from
More informationSingle Pass, BLAST-like, Approximate String Matching on FPGAs*
Single Pass, BLAST-like, Approximate String Matching on FPGAs* Martin Herbordt Josh Model Yongfeng Gu Bharat Sukhwani Tom VanCourt Computer Architecture and Automated Design Laboratory Department of Electrical
More informationCross- Valida+on & ROC curve. Anna Helena Reali Costa PCS 5024
Cross- Valida+on & ROC curve Anna Helena Reali Costa PCS 5024 Resampling Methods Involve repeatedly drawing samples from a training set and refibng a model on each sample. Used in model assessment (evalua+ng
More informationDocument Databases: MongoDB
NDBI040: Big Data Management and NoSQL Databases hp://www.ksi.mff.cuni.cz/~svoboda/courses/171-ndbi040/ Lecture 9 Document Databases: MongoDB Marn Svoboda svoboda@ksi.mff.cuni.cz 28. 11. 2017 Charles University
More informationL4: Blast: Alignment Scores etc.
L4: Blast: Alignment Scores etc. Why is Blast Fast? Silly Question Prove or Disprove: There are two people in New York City with exactly the same number of hairs. Large database search Database (n) Query
More informationInforma(on Retrieval
Introduc*on to Informa(on Retrieval CS276: Informa*on Retrieval and Web Search Pandu Nayak and Prabhakar Raghavan Lecture 12: Clustering Today s Topic: Clustering Document clustering Mo*va*ons Document
More informationSalvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón
trimal: a tool for automated alignment trimming in large-scale phylogenetics analyses Salvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón Version 1.2b Index of contents 1. General features
More informationInforma(on Retrieval
Introduc*on to Informa(on Retrieval Clustering Chris Manning, Pandu Nayak, and Prabhakar Raghavan Today s Topic: Clustering Document clustering Mo*va*ons Document representa*ons Success criteria Clustering
More informationSupervised and Unsupervised Learning. Ciro Donalek Ay/Bi 199 April 2011
Supervised and Unsupervised Learning Ciro Donalek Ay/Bi 199 April 2011 KDD and Data Mining Tasks Finding the op?mal approach Supervised Models Neural Networks Mul? Layer Perceptron Decision Trees Unsupervised
More informationSTA 4273H: Sta-s-cal Machine Learning
STA 4273H: Sta-s-cal Machine Learning Russ Salakhutdinov Department of Statistics! rsalakhu@utstat.toronto.edu! h0p://www.cs.toronto.edu/~rsalakhu/ Lecture 3 Parametric Distribu>ons We want model the probability
More informationCS395T Visual Recogni5on and Search. Gautam S. Muralidhar
CS395T Visual Recogni5on and Search Gautam S. Muralidhar Today s Theme Unsupervised discovery of images Main mo5va5on behind unsupervised discovery is that supervision is expensive Common tasks include
More informationDynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014
Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into
More informationLecture 2. White- box Tes2ng and Structural Coverage (see Amman and Offut, Chapter 2)
Lecture 2 White- box Tes2ng and Structural Coverage (see Amman and Offut, Chapter 2) White- box Tes2ng (aka. Glass- box or structural tes2ng) An error may exist at one (or more) loca2on(s) Line numbers
More informationA Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity
A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity G. Pratyusha, Department of Computer Science & Engineering, V.R.Siddhartha Engineering College(Autonomous)
More informationGLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment
GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment Scoring Dynamic Programming algorithms Heuristic algorithms CLUSTAL W Courtesy of jalview Motivations Collective (or aggregate) statistic
More informationLecture 5: Multiple sequence alignment
Lecture 5: Multiple sequence alignment Introduction to Computational Biology Teresa Przytycka, PhD (with some additions by Martin Vingron) Why do we need multiple sequence alignment Pairwise sequence alignment
More informationMetaPhyler Usage Manual
MetaPhyler Usage Manual Bo Liu boliu@umiacs.umd.edu March 13, 2012 Contents 1 What is MetaPhyler 1 2 Installation 1 3 Quick Start 2 3.1 Taxonomic profiling for metagenomic sequences.............. 2 3.2
More informationHypergraph Sparsifica/on and Its Applica/on to Par//oning
Hypergraph Sparsifica/on and Its Applica/on to Par//oning Mehmet Deveci 1,3, Kamer Kaya 1, Ümit V. Çatalyürek 1,2 1 Dept. of Biomedical Informa/cs, The Ohio State University 2 Dept. of Electrical & Computer
More information