CMSC423: Bioinformatic Algorithms, Databases and Tools Lecture 8. Note
|
|
- Ursula Bridges
- 5 years ago
- Views:
Transcription
1 MS: Bioinformatic lgorithms, Databases and ools Lecture 8 Sequence alignment: inexact alignment dynamic programming, gapped alignment Note Lecture 7 suffix trees and suffix arrays will be rescheduled
2 Exact alignment recap Exact matching can be done efficiently: O( ext + Pattern ) Key idea: preprocess data to keep track of similar regions, then use information to "jump" over places where no match can occur Z KMP B-M Inexact matching: why? Redundancy in genetic code: nucleotide sequence may differ, but proteins the same S Y P D Different amino-acid sequences still fold the same way: function unchanged (generally changing an amino-acid with a similar one doesn't affect protein function) ligning ESs (RN sequences) to DN need to account for gaps corresponding to exons Need to account for sequencing errors
3 Several hemoglobins HBB_HUMN HBB_HORSE HB_HUMN HB_HORSE MY_PHY LB5_PEM LB_LUPLU FFESFDLSPDVMNPKVKHKKVL-----FSDLHLDNLKF FFDSFDLSNPVMNPKVKHKKVL-----HSFEVHHLDNLKF YFPHF-DLS-----HSQVKHKKV-----DLNVHVDDMPNL YFPHF-DLS-----HSQVKHKKV-----DLLVHLDDLPL KFDRFKHLKEEMKSEDLKKHVVL-----LILKKKHHEEL FFPKFKLDQLKKSDVRWHERII-----NVNDVSMDDEKMS LFSFLKSEVP--QNNPELQHKVFKLVYEIQLQVVVVDL * :...:: *. : :. : From
4 Warm-up Longest ommon Subsequence iven two strings of letters, identify longest string of letters that occurs, in the same order, in both strings Find the longest chain of s, moving to the right and down Dynamic programming Idea: re-use previously computed information LS[i,j] longest common subsequence of strings S[..i], S[..j] i LS[i,j] is the maximum of: j.if S[i] = S[j] LS[i-, j-] + else LS[i -, j-]. LS[i, j]. LS[i, j ] oal: find LS[m,n]
5 5 omputing the LS table Row and column easy to fill Fill the rest column by column Find the actual sequence: trace-back pointers Extending to sequence alignment In LS, mis-alignments were free What happens if we pay for our "mistakes"? (this also allows us to account for "similar" aminoacids) Value[, ] = Value[,] = -5 Value[,-] = - etc. he same dynamic programming algorithm works!
6 he recurrences Score[i,j] is the maximum of: Score[i-, j-] + Value[S[i],S[j]] Score[i, j] + Value[S[i], -] (S[i] aligned to gap) Score[i, j ] + Value[-, S[j]] (S[j] aligned to gap) -- - he dynamic programming table Score[i,j] is the maximum of:. Score[i-, j-] + Value[S[i-],S[j-]] (S[i-], S[j-] aligned). Score[i, j] + Value[S[i], -] (S[i] aligned to gap). Score[i, j ] + Value[-, S[j]] (S[j] aligned to gap) Value (, ) = Value (, ) = -5 Value (, -) = - Note: we only look at adjacent boxes 6
7 Local vs. global alignment an we change the algorithm to allow S to be a substring of S? Key idea: gaps at the end of S are free Simply change the first row in the DP table to s nswer is no longer Score[n, m], rather the largest value in the last row Sub-string alignment
8 Local alignment What if we just want a region of similarity? -- First row and column set to s llow alignment to start anywhere: Score[i,j] = max{, case, case, case } nswer is location in matrix with highest score Local alignment 8
9 Various flavors of alignment lignment problem also called "edit distance" how many changes do you have to make to a string to convert it into another one. Edit distance also called Levenshtein distance Local alignment Smith-Waterman lobal alignment Needleman-Wunsch 9
Sequence Alignment (chapter 6) p The biological problem p Global alignment p Local alignment p Multiple alignment
Sequence lignment (chapter 6) p The biological problem p lobal alignment p Local alignment p Multiple alignment Local alignment: rationale p Otherwise dissimilar proteins may have local regions of similarity
More informationSequence analysis Pairwise sequence alignment
UMF11 Introduction to bioinformatics, 25 Sequence analysis Pairwise sequence alignment 1. Sequence alignment Lecturer: Marina lexandersson 12 September, 25 here are two types of sequence alignments, global
More informationSequence Comparison: Dynamic Programming. Genome 373 Genomic Informatics Elhanan Borenstein
Sequence omparison: Dynamic Programming Genome 373 Genomic Informatics Elhanan Borenstein quick review: hallenges Find the best global alignment of two sequences Find the best global alignment of multiple
More informationLecture 10. Sequence alignments
Lecture 10 Sequence alignments Alignment algorithms: Overview Given a scoring system, we need to have an algorithm for finding an optimal alignment for a pair of sequences. We want to maximize the score
More informationOutline. Sequence Alignment. Types of Sequence Alignment. Genomics & Computational Biology. Section 2. How Computers Store Information
enomics & omputational Biology Section Lan Zhang Sep. th, Outline How omputers Store Information Sequence lignment Dot Matrix nalysis Dynamic programming lobal: NeedlemanWunsch lgorithm Local: SmithWaterman
More informationMouse, Human, Chimpanzee
More Alignments 1 Mouse, Human, Chimpanzee Mouse to Human Chimpanzee to Human 2 Mouse v.s. Human Chromosome X of Mouse to Human 3 Local Alignment Given: two sequences S and T Find: substrings of S and
More informationAlignment of Long Sequences
Alignment of Long Sequences BMI/CS 776 www.biostat.wisc.edu/bmi776/ Spring 2009 Mark Craven craven@biostat.wisc.edu Pairwise Whole Genome Alignment: Task Definition Given a pair of genomes (or other large-scale
More informationSpecial course in Computer Science: Advanced Text Algorithms
Special course in Computer Science: Advanced Text Algorithms Lecture 6: Alignments Elena Czeizler and Ion Petre Department of IT, Abo Akademi Computational Biomodelling Laboratory http://www.users.abo.fi/ipetre/textalg
More informationLocal Alignment & Gap Penalties CMSC 423
Local Alignment & ap Penalties CMSC 423 lobal, Semi-global, Local Alignments Last time, we saw a dynamic programming algorithm for global alignment: both strings s and t must be completely matched: s t
More informationAlgorithmic Paradigms. Chapter 6 Dynamic Programming. Steps in Dynamic Programming. Dynamic Programming. Dynamic Programming Applications
lgorithmic Paradigms reed. Build up a solution incrementally, only optimizing some local criterion. hapter Dynamic Programming Divide-and-conquer. Break up a problem into two sub-problems, solve each sub-problem
More informationCMSC423: Bioinformatic Algorithms, Databases and Tools Lecture 12
CMSC423: Bioinformatic Algorithms, Databases and Tools Lecture 12 chaining algorithms multiple alignment CMSC423 Fall 2008 1 Jobs Applied Predictive Technologies looking for the best students focus on
More informationA Design of a Hybrid System for DNA Sequence Alignment
IMECS 2008, 9-2 March, 2008, Hong Kong A Design of a Hybrid System for DNA Sequence Alignment Heba Khaled, Hossam M. Faheem, Tayseer Hasan, Saeed Ghoneimy Abstract This paper describes a parallel algorithm
More informationDynamic Programming Part I: Examples. Bioinfo I (Institut Pasteur de Montevideo) Dynamic Programming -class4- July 25th, / 77
Dynamic Programming Part I: Examples Bioinfo I (Institut Pasteur de Montevideo) Dynamic Programming -class4- July 25th, 2011 1 / 77 Dynamic Programming Recall: the Change Problem Other problems: Manhattan
More informationToday s Lecture. Edit graph & alignment algorithms. Local vs global Computational complexity of pairwise alignment Multiple sequence alignment
Today s Lecture Edit graph & alignment algorithms Smith-Waterman algorithm Needleman-Wunsch algorithm Local vs global Computational complexity of pairwise alignment Multiple sequence alignment 1 Sequence
More informationDynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014
Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into
More informationDynamic Programming & Smith-Waterman algorithm
m m Seminar: Classical Papers in Bioinformatics May 3rd, 2010 m m 1 2 3 m m Introduction m Definition is a method of solving problems by breaking them down into simpler steps problem need to contain overlapping
More informationBiology 644: Bioinformatics
Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find
More informationAlgorithmic Approaches for Biological Data, Lecture #20
Algorithmic Approaches for Biological Data, Lecture #20 Katherine St. John City University of New York American Museum of Natural History 20 April 2016 Outline Aligning with Gaps and Substitution Matrices
More informationComputational Biology Lecture 4: Overlap detection, Local Alignment, Space Efficient Needleman-Wunsch Saad Mneimneh
Computational Biology Lecture 4: Overlap detection, Local Alignment, Space Efficient Needleman-Wunsch Saad Mneimneh Overlap detection: Semi-Global Alignment An overlap of two sequences is considered an
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 04: Variations of sequence alignments http://www.pitt.edu/~mcs2/teaching/biocomp/tutorials/global.html Slides adapted from Dr. Shaojie Zhang (University
More informationSoftware Implementation of Smith-Waterman Algorithm in FPGA
Software Implementation of Smith-Waterman lgorithm in FP NUR FRH IN SLIMN, NUR DLILH HMD SBRI, SYED BDUL MULIB L JUNID, ZULKIFLI BD MJID, BDUL KRIMI HLIM Faculty of Electrical Engineering Universiti eknologi
More informationComputational Genomics and Molecular Biology, Fall
Computational Genomics and Molecular Biology, Fall 2015 1 Sequence Alignment Dannie Durand Pairwise Sequence Alignment The goal of pairwise sequence alignment is to establish a correspondence between the
More informationLecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD
Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Assumptions: Biological sequences evolved by evolution. Micro scale changes: For short sequences (e.g. one
More informationBioinformatics explained: Smith-Waterman
Bioinformatics Explained Bioinformatics explained: Smith-Waterman May 1, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com
More informationSequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it.
Sequence Alignments Overview Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it. Sequence alignment means arranging
More informationBLAST MCDB 187. Friday, February 8, 13
BLAST MCDB 187 BLAST Basic Local Alignment Sequence Tool Uses shortcut to compute alignments of a sequence against a database very quickly Typically takes about a minute to align a sequence against a database
More informationSequence comparison: Local alignment
Sequence comparison: Local alignment Genome 559: Introuction to Statistical an Computational Genomics Prof. James H. Thomas http://faculty.washington.eu/jht/gs559_217/ Review global alignment en traceback
More informationPairwise Sequence Alignment. Zhongming Zhao, PhD
Pairwise Sequence Alignment Zhongming Zhao, PhD Email: zhongming.zhao@vanderbilt.edu http://bioinfo.mc.vanderbilt.edu/ Sequence Similarity match mismatch A T T A C G C G T A C C A T A T T A T G C G A T
More informationBLAST & Genome assembly
BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies November 17, 2012 1 Introduction Introduction 2 BLAST What is BLAST? The algorithm 3 Genome assembly De
More informationPairwise Sequence Alignment: Dynamic Programming Algorithms. COMP Spring 2015 Luay Nakhleh, Rice University
Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 - Spring 2015 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment The number of all possible pairwise alignments (if
More informationFASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm.
FASTA INTRODUCTION Definition (by David J. Lipman and William R. Pearson in 1985) - Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence
More informationBrief review from last class
Sequence Alignment Brief review from last class DNA is has direction, we will use only one (5 -> 3 ) and generate the opposite strand as needed. DNA is a 3D object (see lecture 1) but we will model it
More informationLecture 9: Core String Edits and Alignments
Biosequence Algorithms, Spring 2005 Lecture 9: Core String Edits and Alignments Pekka Kilpeläinen University of Kuopio Department of Computer Science BSA Lecture 9: String Edits and Alignments p.1/30 III:
More informationNotes on Dynamic-Programming Sequence Alignment
Notes on Dynamic-Programming Sequence Alignment Introduction. Following its introduction by Needleman and Wunsch (1970), dynamic programming has become the method of choice for rigorous alignment of DNA
More informationBLAST - Basic Local Alignment Search Tool
Lecture for ic Bioinformatics (DD2450) April 11, 2013 Searching 1. Input: Query Sequence 2. Database of sequences 3. Subject Sequence(s) 4. Output: High Segment Pairs (HSPs) Sequence Similarity Measures:
More informationProgramming assignment for the course Sequence Analysis (2006)
Programming assignment for the course Sequence Analysis (2006) Original text by John W. Romein, adapted by Bart van Houte (bart@cs.vu.nl) Introduction Please note: This assignment is only obligatory for
More informationChapter 3 Dynamic Programming Part 2 Algorithm Theory WS 2012/13 Fabian Kuhn
Chapter 3 Dynamic Programming Part 2 Algorithm Theory WS 2012/13 Fabian Kuhn Dynamic Programming Memoization for increasing the efficiency of a recursive solution: Only the first time a sub problem is
More informationComputational Molecular Biology
Computational Molecular Biology Erwin M. Bakker Lecture 2 Materials used from R. Shamir [2] and H.J. Hoogeboom [4]. 1 Molecular Biology Sequences DNA A, T, C, G RNA A, U, C, G Protein A, R, D, N, C E,
More informationAn Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST
An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise
More informationCompares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.
Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the
More informationDistributed Protein Sequence Alignment
Distributed Protein Sequence Alignment ABSTRACT J. Michael Meehan meehan@wwu.edu James Hearne hearne@wwu.edu Given the explosive growth of biological sequence databases and the computational complexity
More informationSolving the Longest Common Subsequence (LCS) problem using the Associative ASC Processors with Reconfigurable 2D Mesh
Solving the Longest ommon Subsequence (LS) problem using the ssociative S Processors with Virdi Sabegh Singh (dvisor Dr. Robert. Walker) omputer Science Department Kent State University Presentation Outline
More informationApplied Databases. Sebastian Maneth. Lecture 14 Indexed String Search, Suffix Trees. University of Edinburgh - March 9th, 2017
Applied Databases Lecture 14 Indexed String Search, Suffix Trees Sebastian Maneth University of Edinburgh - March 9th, 2017 2 Recap: Morris-Pratt (1970) Given Pattern P, Text T, find all occurrences of
More informationBLAST & Genome assembly
BLAST & Genome assembly Solon P. Pissis Tomáš Flouri Heidelberg Institute for Theoretical Studies May 15, 2014 1 BLAST What is BLAST? The algorithm 2 Genome assembly De novo assembly Mapping assembly 3
More informationSequence alignment algorithms
Sequence alignment algorithms Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 23 rd 27 After this lecture, you can decide when to use local and global sequence alignments
More informationCISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment
CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features
More information24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:
24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid
More informationDatabase Searching Using BLAST
Mahidol University Objectives SCMI512 Molecular Sequence Analysis Database Searching Using BLAST Lecture 2B After class, students should be able to: explain the FASTA algorithm for database searching explain
More informationLecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:
Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating
More informationDynamic Programming: Sequence alignment. CS 466 Saurabh Sinha
Dynamic Programming: Sequence alignment CS 466 Saurabh Sinha DNA Sequence Comparison: First Success Story Finding sequence similarities with genes of known function is a common approach to infer a newly
More informationSequence Alignment & Search
Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version
More informationTCCAGGTG-GAT TGCAAGTGCG-T. Local Sequence Alignment & Heuristic Local Aligners. Review: Probabilistic Interpretation. Chance or true homology?
Local Sequence Alignment & Heuristic Local Aligners Lectures 18 Nov 28, 2011 CSE 527 Computational Biology, Fall 2011 Instructor: Su-In Lee TA: Christopher Miles Monday & Wednesday 12:00-1:20 Johnson Hall
More informationLecture 3: February Local Alignment: The Smith-Waterman Algorithm
CSCI1820: Sequence Alignment Spring 2017 Lecture 3: February 7 Lecturer: Sorin Istrail Scribe: Pranavan Chanthrakumar Note: LaTeX template courtesy of UC Berkeley EECS dept. Notes are also adapted from
More informationPairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University
1 Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment 2 The number of all possible pairwise alignments (if gaps are allowed)
More informationFastA & the chaining problem
FastA & the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 1 Sources for this lecture: Lectures by Volker Heun, Daniel Huson and Knut Reinert,
More informationEECS 4425: Introductory Computational Bioinformatics Fall Suprakash Datta
EECS 4425: Introductory Computational Bioinformatics Fall 2018 Suprakash Datta datta [at] cse.yorku.ca Office: CSEB 3043 Phone: 416-736-2100 ext 77875 Course page: http://www.cse.yorku.ca/course/4425 Many
More informationThe implementation of bit-parallelism for DNA sequence alignment
Journal of Physics: Conference Series PPER OPE CCESS The implementation of bit-parallelism for D sequence alignment To cite this article: Setyorini et al 27 J. Phys.: Conf. Ser. 835 24 View the article
More informationFastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:
FastA and the chaining problem, Gunnar Klau, December 1, 2005, 10:56 4001 4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem
More informationCMSC423: Bioinformatic Algorithms, Databases and Tools. Exact string matching: Suffix trees Suffix arrays
CMSC423: Bioinformatic Algorithms, Databases and Tools Exact string matching: Suffix trees Suffix arrays Searching multiple strings Can we search multiple strings at the same time? Would it help if we
More informationCentral Issues in Biological Sequence Comparison
Central Issues in Biological Sequence Comparison Definitions: What is one trying to find or optimize? Algorithms: Can one find the proposed object optimally or in reasonable time optimize? Statistics:
More informationSequence Alignment. COMPSCI 260 Spring 2016
Sequence Alignment COMPSCI 260 Spring 2016 Why do we want to compare DNA or protein sequences? Find genes similar to known genes IdenGfy important (funcgonal) sequences by finding conserved regions As
More informationLectures 12 and 13 Dynamic programming: weighted interval scheduling
Lectures 12 and 13 Dynamic programming: weighted interval scheduling COMP 523: Advanced Algorithmic Techniques Lecturer: Dariusz Kowalski Lectures 12-13: Dynamic Programming 1 Overview Last week: Graph
More informationInexact Matching, Alignment. See Gusfield, Chapter 9 Dasgupta et al. Chapter 6 (Dynamic Programming)
Inexact Matching, Alignment See Gusfield, Chapter 9 Dasgupta et al. Chapter 6 (Dynamic Programming) Outline Yet more applications of generalized suffix trees, when combined with a least common ancestor
More informationAcceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion.
www.ijarcet.org 54 Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. Hassan Kehinde Bello and Kazeem Alagbe Gbolagade Abstract Biological sequence alignment is becoming popular
More informationAlignment Based Similarity distance Measure for Better Web Sessions Clustering
Available online at www.sciencedirect.com Procedia Computer Science 5 (2011) 450 457 The 2 nd International Conference on Ambient Systems, Networks and Technologies (ANT) Alignment Based Similarity distance
More informationToday s Lecture. Multiple sequence alignment. Improved scoring of pairwise alignments. Affine gap penalties Profiles
Today s Lecture Multiple sequence alignment Improved scoring of pairwise alignments Affine gap penalties Profiles 1 The Edit Graph for a Pair of Sequences G A C G T T G A A T G A C C C A C A T G A C G
More informationLectures by Volker Heun, Daniel Huson and Knut Reinert, in particular last years lectures
4 FastA and the chaining problem We will discuss: Heuristics used by the FastA program for sequence alignment Chaining problem 4.1 Sources for this lecture Lectures by Volker Heun, Daniel Huson and Knut
More informationAs of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be
48 Bioinformatics I, WS 09-10, S. Henz (script by D. Huson) November 26, 2009 4 BLAST and BLAT Outline of the chapter: 1. Heuristics for the pairwise local alignment of two sequences 2. BLAST: search and
More informationAlgorithms and Complexity. Exercise session 3+4
Algorithms and Complexity. Exercise session 3+4 Dynamic Programming Longest Common Substring The string ALGORITHM and the string PLÅGORIS have the common substring GORI. The longest common substring of
More informationTABLE OF CONTENTS PAGE TITLE NO.
TABLE OF CONTENTS CHAPTER PAGE TITLE ABSTRACT iv LIST OF TABLES xi LIST OF FIGURES xii LIST OF ABBREVIATIONS & SYMBOLS xiv 1. INTRODUCTION 1 2. LITERATURE SURVEY 14 3. MOTIVATIONS & OBJECTIVES OF THIS
More informationA Linear Programming Based Algorithm for Multiple Sequence Alignment by Using Markov Decision Process
inear rogramming Based lgorithm for ultiple equence lignment by Using arkov ecision rocess epartment of omputer cience University of aryland, ollege ark hirin ehraban dvisors: r. ern unt and r. hau-en
More informationCHAPTER-6 WEB USAGE MINING USING CLUSTERING
CHAPTER-6 WEB USAGE MINING USING CLUSTERING 6.1 Related work in Clustering Technique 6.2 Quantifiable Analysis of Distance Measurement Techniques 6.3 Approaches to Formation of Clusters 6.4 Conclusion
More informationMultiple Sequence Alignment. Mark Whitsitt - NCSA
Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV
More informationPairwise alignment II
Pairwise alignment II Agenda - Previous Lesson: Minhala + Introduction - Review Dynamic Programming - Pariwise Alignment Biological Motivation Today: - Quick Review: Sequence Alignment (Global, Local,
More information.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar..
.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. PAM and BLOSUM Matrices Prepared by: Jason Banich and Chris Hoover Background As DNA sequences change and evolve, certain amino acids are more
More informationBiochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA)
Biochemistry 324 Bioinformatics Multiple Sequence Alignment (MSA) Big- Οh notation Greek omicron symbol Ο The Big-Oh notation indicates the complexity of an algorithm in terms of execution speed and storage
More informationAn Efficient Algorithm to Locate All Locally Optimal Alignments Between Two Sequences Allowing for Gaps
An Efficient Algorithm to Locate All Locally Optimal Alignments Between Two Sequences Allowing for Gaps Geoffrey J. Barton Laboratory of Molecular Biophysics University of Oxford Rex Richards Building
More informationPairwise Sequence alignment Basic Algorithms
Pairwise Sequence alignment Basic Algorithms Agenda - Previous Lesson: Minhala - + Biological Story on Biomolecular Sequences - + General Overview of Problems in Computational Biology - Reminder: Dynamic
More informationDNA Alignment With Affine Gap Penalties
DNA Alignment With Affine Gap Penalties Laurel Schuster Why Use Affine Gap Penalties? When aligning two DNA sequences, one goal may be to infer the mutations that made them different. Though it s impossible
More information3/5/2018 Lecture15. Comparing Sequences. By Miguel Andrade at English Wikipedia.
3/5/2018 Lecture15 Comparing Sequences By Miguel Andrade at English Wikipedia 1 http://localhost:8888/notebooks/comp555s18/lecture15.ipynb# 1/1 Sequence Similarity A common problem in Biology Insulin Protein
More informationSequence Alignment. Ulf Leser
Sequence Alignment Ulf Leser his Lecture Approximate String Matching Edit distance and alignment Computing global alignments Local alignment Ulf Leser: Bioinformatics, Summer Semester 2016 2 ene Function
More informationCSE : Computational Issues in Molecular Biology. Lecture 7. Spring 2004
CSE 397-497: Computational Issues in Molecular Biology Lecture 7 Spring 2004-1 - CSE seminar on Monday Title: Redundancy Elimination Within Large Collections of Files Speaker: Dr. Fred Douglis (IBM T.J.
More informationDivya R. Singh. Faster Sequence Alignment using Suffix Tree and Data-Mining Techniques. February A Thesis Presented by
Faster Sequence Alignment using Suffix Tree and Data-Mining Techniques A Thesis Presented by Divya R. Singh to The Faculty of the Graduate College of the University of Vermont In Partial Fulfillment of
More informationOPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT
OPEN MP-BASED PARALLEL AND SCALABLE GENETIC SEQUENCE ALIGNMENT Asif Ali Khan*, Laiq Hassan*, Salim Ullah* ABSTRACT: In bioinformatics, sequence alignment is a common and insistent task. Biologists align
More informationLecture 5 Advanced BLAST
Introduction to Bioinformatics for Medical Research Gideon Greenspan gdg@cs.technion.ac.il Lecture 5 Advanced BLAST BLAST Recap Sequence Alignment Complexity and indexing BLASTN and BLASTP Basic parameters
More informationProject Report on. De novo Peptide Sequencing. Course: Math 574 Gaurav Kulkarni Washington State University
Project Report on De novo Peptide Sequencing Course: Math 574 Gaurav Kulkarni Washington State University Introduction Protein is the fundamental building block of one s body. Many biological processes
More informationPrinciples of Bioinformatics. BIO540/STA569/CSI660 Fall 2010
Principles of Bioinformatics BIO540/STA569/CSI660 Fall 2010 Lecture 11 Multiple Sequence Alignment I Administrivia Administrivia The midterm examination will be Monday, October 18 th, in class. Closed
More informationEfficient Implementation of a Generalized Pair HMM for Comparative Gene Finding. B. Majoros M. Pertea S.L. Salzberg
Efficient Implementation of a Generalized Pair HMM for Comparative Gene Finding B. Majoros M. Pertea S.L. Salzberg ab initio gene finder genome 1 MUMmer Whole-genome alignment (optional) ROSE Region-Of-Synteny
More informationHighly Scalable and Accurate Seeds for Subsequence Alignment
Highly Scalable and Accurate Seeds for Subsequence Alignment Abhijit Pol Tamer Kahveci Department of Computer and Information Science and Engineering, University of Florida, Gainesville, FL, USA, 32611
More informationBGGN 213 Foundations of Bioinformatics Barry Grant
BGGN 213 Foundations of Bioinformatics Barry Grant http://thegrantlab.org/bggn213 Recap From Last Time: 25 Responses: https://tinyurl.com/bggn213-02-f17 Why ALIGNMENT FOUNDATIONS Why compare biological
More information15-780: Graduate Artificial Intelligence. Computational biology: Sequence alignment and profile HMMs
5-78: Graduate rtificial Intelligence omputational biology: Sequence alignment and profile HMMs entral dogma DN GGGG transcription mrn UGGUUUGUG translation Protein PEPIDE 2 omparison of Different Organisms
More informationDivide and Conquer. Bioinformatics: Issues and Algorithms. CSE Fall 2007 Lecture 12
Divide and Conquer Bioinformatics: Issues and Algorithms CSE 308-408 Fall 007 Lecture 1 Lopresti Fall 007 Lecture 1-1 - Outline MergeSort Finding mid-point in alignment matrix in linear space Linear space
More information- G T G T A C A C
Name Student ID.. Sequence alignment 1. Globally align sequence V (GTGTACAC) and sequence W (GTACC) by hand using dynamic programming algorithm. The alignment will be performed based on match premium of
More informationAccelerating Smith Waterman (SW) Algorithm on Altera Cyclone II Field Programmable Gate Array
Accelerating Smith Waterman (SW) Algorithm on Altera yclone II Field Programmable Gate Array NUR DALILAH AHMAD SABRI, NUR FARAH AIN SALIMAN, SYED ABDUL MUALIB AL JUNID, ABDUL KARIMI HALIM Faculty Electrical
More informationBioinformatics for Biologists
Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover
More informationJyoti Lakhani 1, Ajay Khunteta 2, Dharmesh Harwani *3 1 Poornima University, Jaipur & Maharaja Ganga Singh University, Bikaner, Rajasthan, India
International Journal of Scientific Research in Computer Science, Engineering and Information Technology 2017 IJSRCSEIT Volume 2 Issue 6 ISSN : 2456-3307 Improvisation of Global Pairwise Sequence Alignment
More informationGlobal Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties
Global Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties From LCS to Alignment: Change the Scoring The Longest Common Subsequence (LCS) problem the simplest form of sequence
More informationAn FPGA-Based Web Server for High Performance Biological Sequence Alignment
2009 NS/ES onference on daptive Hardware and Systems n FPG-Based Web Server for High Performance Biological Sequence lignment Ying Liu 1, Khaled Benkrid 1, bdsamad Benkrid 2 and Server Kasap 1 1 Institute
More informationFrom Smith-Waterman to BLAST
From Smith-Waterman to BLAST Jeremy Buhler July 23, 2015 Smith-Waterman is the fundamental tool that we use to decide how similar two sequences are. Isn t that all that BLAST does? In principle, it is
More informationAlgorithm Design and Analysis
Algorithm Design and Analysis LECTURE 16 Dynamic Programming Least Common Subsequence Saving space Adam Smith Least Common Subsequence A.k.a. sequence alignment edit distance Longest Common Subsequence
More information