- G T G T A C A C
|
|
- Augustus Craig
- 5 years ago
- Views:
Transcription
1 Name Student ID.. Sequence alignment 1. Globally align sequence V (GTGTACAC) and sequence W (GTACC) by hand using dynamic programming algorithm. The alignment will be performed based on match premium of 2, mismatch score of -3 and gap penalty of -1. Calculation - G T G T A C A C - G T A C C Answer - G T G T A C A C G T A C C
2 Write down the alignment # Alignment 1 (Yellow path) V G T G T A C A C W - - G T A C - C Alignment 2 (Green and yellow path) V G T G T A C A C W G T - - A C C Alignment 3 (Green, blue and yellow path) V G T G T A C A C W G - - T A C C Calculate the alignment score for the above alignment using match/mismatch score above and an affine gap penalty with gap opening of -5 and gap extension of -2. Please provide both the calculation process and the alignment score. # Because every alignment presents 2 gaps: one carries 2 residues and another carries 1 residue, thus the alignment score of every alignment could be calculated as follows. Score: 2(5) + [-5+2(-2)]+[-5+1(-2)] = = Calculate alignment score of the following alignments using BLOSUM62 with gap opening of 10 and gap extension of 0.5. Also specify the type of alignment. 2.1 FTFTALILLAVAV Alignment type: # Global alignment F--TAL-LLA-AV Alignment score: # (6+5+(7*4))-(10*3)-(0.5*4) = FTALILL-AV Alignment type: # Local alignment FTAL-LLAAV Alignment score: # (6+5+(7*4))-(10*1)-(0.5*1) = Follow steps shown below to align cxea gene of Dictyostelium discoideum AX4 strain to its cdna sequence. 1) Go to the EBI website ( 2
3 2) Under the local alignment section, choose program Water > Nucleotide 3) Copy both DNA and cdna sequence of cxea gene of Dictyostelium discoideum AX4 strain, and then paste on the box as shown below. 4) Take a look at all parameters used for performing pairwise sequence alignment using Smith-Waterman algorithm (local sequence alignment). 3
4 Parameters: Matrix, Gap opening and Gap extension 5) Click submit and wait until you see the result as follows Summary result 6) You can copy the result in a new notepad and save it as a text file (.txt). Based on the alignment result, how many exons does the cxea gene in Dictyostelium discoideum AX4 strain carry? # This sequence contained 2 exons. The alignment result was saved in the file named Ddiscoidium_cxeA_alingment.txt. You can use Aliview to view the alignment 4
5 If you perform this analysis using global sequence alignment, will you obtain the same result as that provided by the local sequence alignment? # The results are the same because the regions containing matched residues are identical. How could you verify that your predicted number of exons is correct? # There are a number of ways you can used to verify the predicted number of exon; for example, you can translate the concatenated exons and compare the translated nucleotide sequence to the protein database sequence, then check whether the most similar protein is the cxea protein or not. 4. Use the pairwise sequence alignment method to align sequence of the E gene of DENV-3 to that of DENV-4. The steps to perform global sequence alignment are shown below. 1) Go to the EBI website ( 2) Under the global alignment section, choose program Needle > Nucleotide 3) Copy DNA sequence of DENV-3 and DENV-4, then paste on the box as shown below. 5
6 4) Take a look at all parameters used for performing pairwise sequence alignment using Needle-W algorithm (global sequence alignment). Parameters: Matrix, Gap opening and Gap extension Extra parameter: End gap penalty 5) Click submit and wait until you see the result as follows. 6
7 Summary result 6) You can copy the result in a new notepad and save it as a text file (.txt). Based on the alignment result, how much are the similarity of the DNA sequences between the E gene of dengue virus serotype 3 (DENV-3) and E gene of dengue virus serotype 4 (DENV-4)? # In case of nucleotide sequence, percent similarity is the same as percent identity which in this case is 65%. How could you evaluate whether this alignment is correct or not? # You can align amino acid sequences in addition to the nucleotide sequence alignment, then compare the amino acid sequence alignment to the translated nucleotide sequence alignment. We have done this task when we practice section no Follow the steps shown below to locate the envelope protein domain Iii on the envelope protein sequence of the dengue virus serotype 3 (DENV-3). 1) Go to the EBI website ( 7
8 2) Under the local alignment section, choose program Water > Protein 3) Copy amino acid sequence of DENV-3 envelope protein and the envelope protein domain Iii, then paste on the box as shown below. 4) Take a look at all parameters used for performing pairwise sequence alignment using Needle-W algorithm (global sequence alignment). 8
9 Parameters: Matrix, Gap opening and Gap extension 5) Click submit and wait until you see the result as follows. Summary result 6) You can copy the result in a new notepad and save it as a text file (.txt). Where is the envelope protein domain Iii on the DENV-3 envelope protein? Please answer this question by stating the amino acid positions on the DENV-3 envelope protein. # Based on the result shown above, the envelope protein domain Iii is located from amino acid 290 to
10 6. Align E gene and envelope protein sequences of dengue virus (DENV-1,2,3 and 4) using G-INS-i in MAFFT. Follow the steps below to align nucleotide sequences. 1) Go to the to download program Aliview. This program will be used to view aligned sequences. Please read install instruction on the website. 10 2) Follow the link here to the MAFFT website.
11 3) Choose to perform Alignment. This function is located on the left-handed side menu as follow. 4) After clicking the Alignment, copy DNA sequences of the DENV-1 to 4 and paste to the box as follows. 5) Set parameter values as follows. Any hidden option/parameter was left as default setting. 11
12 12 6) Click submit. After a while, you will see the alignment result as follows.
13 This alignment is in clustal format. 7) Click Fasta format, then you will see the alignment in fasta format. Copy the alignment and paste on a new notepad, then save the alignment file as a text with extension.txt or.fasta. 8) Open the program Aliview. Click File > Open file, then choose your alignment file. You will see the alignment as follows. 13
14 Click as follows. These steps will translate you DNA sequence to amino acid sequence alignment. Make sure that you choose Standard code and Reading frame ) You can apply these steps to align envelope protein sequences of these dengue viruses. After aligning the protein sequences, save the result in a fasta format. 10) Compare the amino acid sequence alignment obtained from step 9) to the translated nucleotide sequence alignment obtained from step 8). Manually correct your DNA sequence alignment based on the amino acid sequence alignment. How many positions in the DNA sequence alignment do you need to edit in order to correct the DNA sequence alignment? # After comparing amino acid to nucleotide sequence alignment, you would see that you need to move nucleotide from position 471 to 465. The alignment would change from Fig.1 to Fig.2 as follows which after translation, the alignment would look just like the amino acid sequence alignment. Fig. 1 Fig. 2 14
15 7. Apply sequence alignment technique to answer the following questions. Explain how you align sequences by informing what method and options/parameters you have chosen. If the alignment needs to be manually edited, please state that the result obtained from the manually edited alignment. 7.1 How many exons are there in the luciferase gene of Luciola lateralis? # I performed a local pairwise sequence alignment using EMBOSS Water with default parameter values shown as follows. The result showed that this gene contains 7 exons. The alignment result is saved in the file named Luciferase_local_alignment.pdf. 7.2 Where are the conserved regions in the mtcoi gene of fireflies? Until recently, there are six complete mtgenome sequences of fireflies: Asymmetricata circumdata, Bicellonychia lividipennis, Luciola substriata, Aquatica leii, Luciola cruciate, Pyrocoelia rufa, that are available in the GenBank database. The mtcoi sequence of Rhagophthalmus lufengensis was used as an outgroup here. Answer this question by writing down the alignment of the longest conserved region observed in the alignment. # I performed multiple sequence alignment using MAFFT with option Auto and default parameter values. The alignment at the 3 end needs to be edit and the alignment at the 3 end would change from as shown in Fig.1 to that as shown in Fig. 2 Fig. 1 Fig. 2 The longest conserved region is located from position 340 to position 348 as follows. 15
Lab 4: Multiple Sequence Alignment (MSA)
Lab 4: Multiple Sequence Alignment (MSA) The objective of this lab is to become familiar with the features of several multiple alignment and visualization tools, including the data input and output, basic
More informationCompares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.
Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the
More informationToday s Lecture. Multiple sequence alignment. Improved scoring of pairwise alignments. Affine gap penalties Profiles
Today s Lecture Multiple sequence alignment Improved scoring of pairwise alignments Affine gap penalties Profiles 1 The Edit Graph for a Pair of Sequences G A C G T T G A A T G A C C C A C A T G A C G
More informationFASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm.
FASTA INTRODUCTION Definition (by David J. Lipman and William R. Pearson in 1985) - Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence
More informationPrinciples of Bioinformatics. BIO540/STA569/CSI660 Fall 2010
Principles of Bioinformatics BIO540/STA569/CSI660 Fall 2010 Lecture 11 Multiple Sequence Alignment I Administrivia Administrivia The midterm examination will be Monday, October 18 th, in class. Closed
More informationDatabase Searching Using BLAST
Mahidol University Objectives SCMI512 Molecular Sequence Analysis Database Searching Using BLAST Lecture 2B After class, students should be able to: explain the FASTA algorithm for database searching explain
More informationBioinformatics for Biologists
Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover
More informationBasic Local Alignment Search Tool (BLAST)
BLAST 26.04.2018 Basic Local Alignment Search Tool (BLAST) BLAST (Altshul-1990) is an heuristic Pairwise Alignment composed by six-steps that search for local similarities. The most used access point to
More information.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar..
.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. PAM and BLOSUM Matrices Prepared by: Jason Banich and Chris Hoover Background As DNA sequences change and evolve, certain amino acids are more
More informationData Walkthrough: Background
Data Walkthrough: Background File Types FASTA Files FASTA files are text-based representations of genetic information. They can contain nucleotide or amino acid sequences. For this activity, students will
More informationGlobal Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties
Global Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties From LCS to Alignment: Change the Scoring The Longest Common Subsequence (LCS) problem the simplest form of sequence
More informationPROTEIN MULTIPLE ALIGNMENT MOTIVATION: BACKGROUND: Marina Sirota
Marina Sirota MOTIVATION: PROTEIN MULTIPLE ALIGNMENT To study evolution on the genetic level across a wide range of organisms, biologists need accurate tools for multiple sequence alignment of protein
More informationA multiple alignment tool in 3D
Outline Department of Computer Science, Bioinformatics Group University of Leipzig TBI Winterseminar Bled, Slovenia February 2005 Outline Outline 1 Multiple Alignments Problems Goal Outline Outline 1 Multiple
More informationHeuristic methods for pairwise alignment:
Bi03c_1 Unit 03c: Heuristic methods for pairwise alignment: k-tuple-methods k-tuple-methods for alignment of pairs of sequences Bi03c_2 dynamic programming is too slow for large databases Use heuristic
More informationCISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment
CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features
More informationBLAST, Profile, and PSI-BLAST
BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources
More informationSequence analysis Pairwise sequence alignment
UMF11 Introduction to bioinformatics, 25 Sequence analysis Pairwise sequence alignment 1. Sequence alignment Lecturer: Marina lexandersson 12 September, 25 here are two types of sequence alignments, global
More informationBiology 644: Bioinformatics
Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find
More informationAlignment of Pairs of Sequences
Bi03a_1 Unit 03a: Alignment of Pairs of Sequences Partners for alignment Bi03a_2 Protein 1 Protein 2 =amino-acid sequences (20 letter alphabeth + gap) LGPSSKQTGKGS-SRIWDN LN-ITKSAGKGAIMRLGDA -------TGKG--------
More informationDynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014
Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into
More informationMultiple Sequence Alignment. Mark Whitsitt - NCSA
Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV
More informationCS313 Exercise 4 Cover Page Fall 2017
CS313 Exercise 4 Cover Page Fall 2017 Due by the start of class on Thursday, October 12, 2017. Name(s): In the TIME column, please estimate the time you spent on the parts of this exercise. Please try
More informationSequence alignment algorithms
Sequence alignment algorithms Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 23 rd 27 After this lecture, you can decide when to use local and global sequence alignments
More informationAlgorithmic Approaches for Biological Data, Lecture #20
Algorithmic Approaches for Biological Data, Lecture #20 Katherine St. John City University of New York American Museum of Natural History 20 April 2016 Outline Aligning with Gaps and Substitution Matrices
More informationLecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD
Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Assumptions: Biological sequences evolved by evolution. Micro scale changes: For short sequences (e.g. one
More informationSalvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón
trimal: a tool for automated alignment trimming in large-scale phylogenetics analyses Salvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón Version 1.2b Index of contents 1. General features
More informationProgramming assignment for the course Sequence Analysis (2006)
Programming assignment for the course Sequence Analysis (2006) Original text by John W. Romein, adapted by Bart van Houte (bart@cs.vu.nl) Introduction Please note: This assignment is only obligatory for
More informationSimilarity Searches on Sequence Databases
Similarity Searches on Sequence Databases Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Zürich, October 2004 Swiss Institute of Bioinformatics Swiss EMBnet node Outline Importance of
More informationAs of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be
48 Bioinformatics I, WS 09-10, S. Henz (script by D. Huson) November 26, 2009 4 BLAST and BLAT Outline of the chapter: 1. Heuristics for the pairwise local alignment of two sequences 2. BLAST: search and
More informationBiostatistics and Bioinformatics Molecular Sequence Databases
. 1 Description of Module Subject Name Paper Name Module Name/Title 13 03 Dr. Vijaya Khader Dr. MC Varadaraj 2 1. Objectives: In the present module, the students will learn about 1. Encoding linear sequences
More informationBIOL591: Introduction to Bioinformatics Alignment of pairs of sequences
BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences Reading in text (Mount Bioinformatics): I must confess that the treatment in Mount of sequence alignment does not seem to me a model
More informationBioinformatics explained: Smith-Waterman
Bioinformatics Explained Bioinformatics explained: Smith-Waterman May 1, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com
More informationIntroduction to Phylogenetics Week 2. Databases and Sequence Formats
Introduction to Phylogenetics Week 2 Databases and Sequence Formats I. Databases Crucial to bioinformatics The bigger the database, the more comparative research data Requires scientists to upload data
More informationHomology Modeling FABP
Homology Modeling FABP Homology modeling is a technique used to approximate the 3D structure of a protein when no experimentally determined structure exists. It operates under the principle that protein
More informationComputational Genomics and Molecular Biology, Fall
Computational Genomics and Molecular Biology, Fall 2015 1 Sequence Alignment Dannie Durand Pairwise Sequence Alignment The goal of pairwise sequence alignment is to establish a correspondence between the
More informationIn this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace.
5 Multiple Match Refinement and T-Coffee In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace. This exposition
More informationWilson Leung 01/03/2018 An Introduction to NCBI BLAST. Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment
An Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at https://blast.ncbi.nlm.nih.gov/blast.cgi
More informationCMSC 423 Fall 2009: Project Specification
CMSC 423 Fall 2009: Project Specification Introduction The project will consist of four components due throughout the semester (see below for timeline). Basic rules: You are allowed to work in teams of
More informationLecture 5 Advanced BLAST
Introduction to Bioinformatics for Medical Research Gideon Greenspan gdg@cs.technion.ac.il Lecture 5 Advanced BLAST BLAST Recap Sequence Alignment Complexity and indexing BLASTN and BLASTP Basic parameters
More informationSubmitting allele sequences to the GenBank NGSengine allele submission Sequin
1 Submitting allele sequences to the GenBank 1 2 NGSengine allele submission 1 2.1 NGSengine restrictions 1 2.2 Allele names 2 2.3 Generating the fasta file and feature table 2 3 Sequin 2 3.1 Generating
More informationBLAST MCDB 187. Friday, February 8, 13
BLAST MCDB 187 BLAST Basic Local Alignment Sequence Tool Uses shortcut to compute alignments of a sequence against a database very quickly Typically takes about a minute to align a sequence against a database
More informationICB Fall G4120: Introduction to Computational Biology. Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology
ICB Fall 2008 G4120: Computational Biology Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology Copyright 2008 Oliver Jovanovic, All Rights Reserved. The Digital Language of Computers
More informationSimilarity searches in biological sequence databases
Similarity searches in biological sequence databases Volker Flegel september 2004 Page 1 Outline Keyword search in databases General concept Examples SRS Entrez Expasy Similarity searches in databases
More informationCAP BLAST. BIOINFORMATICS Su-Shing Chen CISE. 8/20/2005 Su-Shing Chen, CISE 1
CAP 5510-6 BLAST BIOINFORMATICS Su-Shing Chen CISE 8/20/2005 Su-Shing Chen, CISE 1 BLAST Basic Local Alignment Prof Search Su-Shing Chen Tool A Fast Pair-wise Alignment and Database Searching Tool 8/20/2005
More informationBiochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA)
Biochemistry 324 Bioinformatics Multiple Sequence Alignment (MSA) Big- Οh notation Greek omicron symbol Ο The Big-Oh notation indicates the complexity of an algorithm in terms of execution speed and storage
More informationA Design of a Hybrid System for DNA Sequence Alignment
IMECS 2008, 9-2 March, 2008, Hong Kong A Design of a Hybrid System for DNA Sequence Alignment Heba Khaled, Hossam M. Faheem, Tayseer Hasan, Saeed Ghoneimy Abstract This paper describes a parallel algorithm
More informationSequence alignment theory and applications Session 3: BLAST algorithm
Sequence alignment theory and applications Session 3: BLAST algorithm Introduction to Bioinformatics online course : IBT Sonal Henson Learning Objectives Understand the principles of the BLAST algorithm
More informationAn Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST
An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise
More informationTutorial 4 BLAST Searching the CHO Genome
Tutorial 4 BLAST Searching the CHO Genome Accessing the CHO Genome BLAST Tool The CHO BLAST server can be accessed by clicking on the BLAST button on the home page or by selecting BLAST from the menu bar
More informationPairwise Sequence Alignment: Dynamic Programming Algorithms. COMP Spring 2015 Luay Nakhleh, Rice University
Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 - Spring 2015 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment The number of all possible pairwise alignments (if
More informationBLAST - Basic Local Alignment Search Tool
Lecture for ic Bioinformatics (DD2450) April 11, 2013 Searching 1. Input: Query Sequence 2. Database of sequences 3. Subject Sequence(s) 4. Output: High Segment Pairs (HSPs) Sequence Similarity Measures:
More informationMultiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences
Multiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences Yue Lu and Sing-Hoi Sze RECOMB 2007 Presented by: Wanxing Xu March 6, 2008 Content Biology Motivation Computation Problem
More informationPairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University
1 Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment 2 The number of all possible pairwise alignments (if gaps are allowed)
More informationB L A S T! BLAST: Basic local alignment search tool. Copyright notice. February 6, Pairwise alignment: key points. Outline of tonight s lecture
February 6, 2008 BLAST: Basic local alignment search tool B L A S T! Jonathan Pevsner, Ph.D. Introduction to Bioinformatics pevsner@jhmi.edu 4.633.0 Copyright notice Many of the images in this powerpoint
More informationCMSC423: Bioinformatic Algorithms, Databases and Tools Lecture 8. Note
MS: Bioinformatic lgorithms, Databases and ools Lecture 8 Sequence alignment: inexact alignment dynamic programming, gapped alignment Note Lecture 7 suffix trees and suffix arrays will be rescheduled Exact
More informationBioinformatics explained: BLAST. March 8, 2007
Bioinformatics Explained Bioinformatics explained: BLAST March 8, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com Bioinformatics
More informationLecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:
Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating
More informationJyoti Lakhani 1, Ajay Khunteta 2, Dharmesh Harwani *3 1 Poornima University, Jaipur & Maharaja Ganga Singh University, Bikaner, Rajasthan, India
International Journal of Scientific Research in Computer Science, Engineering and Information Technology 2017 IJSRCSEIT Volume 2 Issue 6 ISSN : 2456-3307 Improvisation of Global Pairwise Sequence Alignment
More informationPairwise Sequence Alignment. Zhongming Zhao, PhD
Pairwise Sequence Alignment Zhongming Zhao, PhD Email: zhongming.zhao@vanderbilt.edu http://bioinfo.mc.vanderbilt.edu/ Sequence Similarity match mismatch A T T A C G C G T A C C A T A T T A T G C G A T
More informationDynamic Programming & Smith-Waterman algorithm
m m Seminar: Classical Papers in Bioinformatics May 3rd, 2010 m m 1 2 3 m m Introduction m Definition is a method of solving problems by breaking them down into simpler steps problem need to contain overlapping
More informationEECS 4425: Introductory Computational Bioinformatics Fall Suprakash Datta
EECS 4425: Introductory Computational Bioinformatics Fall 2018 Suprakash Datta datta [at] cse.yorku.ca Office: CSEB 3043 Phone: 416-736-2100 ext 77875 Course page: http://www.cse.yorku.ca/course/4425 Many
More informationSequence Alignment & Search
Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version
More informationSequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC--
Sequence Alignment Sequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC-- TAG-CTATCAC--GACCGC--GGTCGATTTGCCCGAC Distance from sequences
More informationPage 1.1 Guidelines 2 Requirements JCoDA package Input file formats License. 1.2 Java Installation 3-4 Not required in all cases
JCoDA and PGI Tutorial Version 1.0 Date 03/16/2010 Page 1.1 Guidelines 2 Requirements JCoDA package Input file formats License 1.2 Java Installation 3-4 Not required in all cases 2.1 dn/ds calculation
More informationLecture 10. Sequence alignments
Lecture 10 Sequence alignments Alignment algorithms: Overview Given a scoring system, we need to have an algorithm for finding an optimal alignment for a pair of sequences. We want to maximize the score
More information3.4 Multiple sequence alignment
3.4 Multiple sequence alignment Why produce a multiple sequence alignment? Using more than two sequences results in a more convincing alignment by revealing conserved regions in ALL of the sequences Aligned
More informationFinding Selection in All the Right Places TA Notes and Key Lab 9
Objectives: Finding Selection in All the Right Places TA Notes and Key Lab 9 1. Use published genome data to look for evidence of selection in individual genes. 2. Understand the need for DNA sequence
More informationEBI services. Jennifer McDowall EMBL-EBI
EBI services Jennifer McDowall EMBL-EBI The SLING project is funded by the European Commission within Research Infrastructures of the FP7 Capacities Specific Programme, grant agreement number 226073 (Integrating
More informationFinding homologous sequences in databases
Finding homologous sequences in databases There are multiple algorithms to search sequences databases BLAST (EMBL, NCBI, DDBJ, local) FASTA (EMBL, local) For protein only databases scan via Smith-Waterman
More informationComputational Molecular Biology
Computational Molecular Biology Erwin M. Bakker Lecture 2 Materials used from R. Shamir [2] and H.J. Hoogeboom [4]. 1 Molecular Biology Sequences DNA A, T, C, G RNA A, U, C, G Protein A, R, D, N, C E,
More informationWilson Leung 05/27/2008 A Simple Introduction to NCBI BLAST
A Simple Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at http://www.ncbi.nih.gov/blast/
More informationNotes on Dynamic-Programming Sequence Alignment
Notes on Dynamic-Programming Sequence Alignment Introduction. Following its introduction by Needleman and Wunsch (1970), dynamic programming has become the method of choice for rigorous alignment of DNA
More informationLecture 4: January 1, Biological Databases and Retrieval Systems
Algorithms for Molecular Biology Fall Semester, 1998 Lecture 4: January 1, 1999 Lecturer: Irit Orr Scribe: Irit Gat and Tal Kohen 4.1 Biological Databases and Retrieval Systems In recent years, biological
More informationSequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it.
Sequence Alignments Overview Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it. Sequence alignment means arranging
More informationBIR pipeline steps and subsequent output files description STEP 1: BLAST search
Lifeportal (Brief description) The Lifeportal at University of Oslo (https://lifeportal.uio.no) is a Galaxy based life sciences portal lifeportal.uio.no under the UiO tools section for phylogenomic analysis,
More informationFilogeografía BIOL 4211, Universidad de los Andes 25 de enero a 01 de abril 2006
Laboratory excercise written by Andrew J. Crawford with the support of CIES Fulbright Program and Fulbright Colombia. Enjoy! Filogeografía BIOL 4211, Universidad de los Andes 25 de enero
More informationEECS730: Introduction to Bioinformatics
EECS730: Introduction to Bioinformatics Lecture 04: Variations of sequence alignments http://www.pitt.edu/~mcs2/teaching/biocomp/tutorials/global.html Slides adapted from Dr. Shaojie Zhang (University
More informationSequence Alignment. GBIO0002 Archana Bhardwaj University of Liege
Sequence Alignment GBIO0002 Archana Bhardwaj University of Liege 1 What is Sequence Alignment? A sequence alignment is a way of arranging the sequences of DNA, RNA, or protein to identify regions of similarity.
More informationCOMPARATIVE MICROBIAL GENOMICS ANALYSIS WORKSHOP. Exercise 2: Predicting Protein-encoding Genes, BlastMatrix, BlastAtlas
COMPARATIVE MICROBIAL GENOMICS ANALYSIS WORKSHOP Exercise 2: Predicting Protein-encoding Genes, BlastMatrix, BlastAtlas First of all connect once again to the CBS system: Open ssh shell client. Press Quick
More informationBioinformatics. Sequence alignment BLAST Significance. Next time Protein Structure
Bioinformatics Sequence alignment BLAST Significance Next time Protein Structure 1 Experimental origins of sequence data The Sanger dideoxynucleotide method F Each color is one lane of an electrophoresis
More informationCS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores.
CS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores. prepared by Oleksii Kuchaiev, based on presentation by Xiaohui Xie on February 20th. 1 Introduction
More informationProfiles and Multiple Alignments. COMP 571 Luay Nakhleh, Rice University
Profiles and Multiple Alignments COMP 571 Luay Nakhleh, Rice University Outline Profiles and sequence logos Profile hidden Markov models Aligning profiles Multiple sequence alignment by gradual sequence
More informationSequence Alignment. part 2
Sequence Alignment part 2 Dynamic programming with more realistic scoring scheme Using the same initial sequences, we ll look at a dynamic programming example with a scoring scheme that selects for matches
More informationAcceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion.
www.ijarcet.org 54 Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. Hassan Kehinde Bello and Kazeem Alagbe Gbolagade Abstract Biological sequence alignment is becoming popular
More informationINTRODUCTION TO BIOINFORMATICS
Molecular Biology-2017 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain
More informationDynamic Programming: Sequence alignment. CS 466 Saurabh Sinha
Dynamic Programming: Sequence alignment CS 466 Saurabh Sinha DNA Sequence Comparison: First Success Story Finding sequence similarities with genes of known function is a common approach to infer a newly
More informationShortest Path Algorithm
Shortest Path Algorithm C Works just fine on this graph. C Length of shortest path = Copyright 2005 DIMACS BioMath Connect Institute Robert Hochberg Dynamic Programming SP #1 Same Questions, Different
More informationLecture 10: Local Alignments
Lecture 10: Local Alignments Study Chapter 6.8-6.10 1 Outline Edit Distances Longest Common Subsequence Global Sequence Alignment Scoring Matrices Local Sequence Alignment Alignment with Affine Gap Penalties
More informationBLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha
BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio. 1990. CS 466 Saurabh Sinha Motivation Sequence homology to a known protein suggest function of newly sequenced protein Bioinformatics
More informationToday s Lecture. Edit graph & alignment algorithms. Local vs global Computational complexity of pairwise alignment Multiple sequence alignment
Today s Lecture Edit graph & alignment algorithms Smith-Waterman algorithm Needleman-Wunsch algorithm Local vs global Computational complexity of pairwise alignment Multiple sequence alignment 1 Sequence
More informationMachine Learning. Computational biology: Sequence alignment and profile HMMs
10-601 Machine Learning Computational biology: Sequence alignment and profile HMMs Central dogma DNA CCTGAGCCAACTATTGATGAA transcription mrna CCUGAGCCAACUAUUGAUGAA translation Protein PEPTIDE 2 Growth
More informationSWAMP: Smith-Waterman using Associative Massive Parallelism
SWAMP: Smith-Waterman using Associative Massive Parallelism Shannon Steinfadt Dr. Johnnie W. Baker Department of Computer Science, Kent State University, Kent, Ohio 44242 USA ssteinfa@cs.kent.edu jbaker@cs.kent.edu
More informationA Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity
A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity G. Pratyusha, Department of Computer Science & Engineering, V.R.Siddhartha Engineering College(Autonomous)
More informationGLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment
GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment Scoring Dynamic Programming algorithms Heuristic algorithms CLUSTAL W Courtesy of jalview Motivations Collective (or aggregate) statistic
More information24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:
24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid
More informationMouse, Human, Chimpanzee
More Alignments 1 Mouse, Human, Chimpanzee Mouse to Human Chimpanzee to Human 2 Mouse v.s. Human Chromosome X of Mouse to Human 3 Local Alignment Given: two sequences S and T Find: substrings of S and
More informationVectorBase Web Apollo April Web Apollo 1
Web Apollo 1 Contents 1. Access points: Web Apollo, Genome Browser and BLAST 2. How to identify genes that need to be annotated? 3. Gene manual annotations 4. Metadata 1. Access points Web Apollo tool
More informationOne report (in pdf format) addressing each of following questions.
MSCBIO 2070/02-710: Computational Genomics, Spring 2016 HW1: Sequence alignment and Evolution Due: 24:00 EST, Feb 15, 2016 by autolab Your goals in this assignment are to 1. Complete a genome assembler
More informationAlignMe Manual. Version 1.1. Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest
AlignMe Manual Version 1.1 Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest Max Planck Institute of Biophysics Frankfurt am Main 60438 Germany 1) Introduction...3 2) Using AlignMe
More informationMultiple Sequence Alignment Theory and Applications
Mahidol University Objectives SMI512 Molecular Sequence alysis Multiple Sequence lignment Theory and pplications Lecture 3 Pravech jawatanawong, Ph.. e-mail: pravech.aja@mahidol.edu epartment of Microbiology
More information