- G T G T A C A C

Size: px
Start display at page:

Download "- G T G T A C A C"

Transcription

1 Name Student ID.. Sequence alignment 1. Globally align sequence V (GTGTACAC) and sequence W (GTACC) by hand using dynamic programming algorithm. The alignment will be performed based on match premium of 2, mismatch score of -3 and gap penalty of -1. Calculation - G T G T A C A C - G T A C C Answer - G T G T A C A C G T A C C

2 Write down the alignment # Alignment 1 (Yellow path) V G T G T A C A C W - - G T A C - C Alignment 2 (Green and yellow path) V G T G T A C A C W G T - - A C C Alignment 3 (Green, blue and yellow path) V G T G T A C A C W G - - T A C C Calculate the alignment score for the above alignment using match/mismatch score above and an affine gap penalty with gap opening of -5 and gap extension of -2. Please provide both the calculation process and the alignment score. # Because every alignment presents 2 gaps: one carries 2 residues and another carries 1 residue, thus the alignment score of every alignment could be calculated as follows. Score: 2(5) + [-5+2(-2)]+[-5+1(-2)] = = Calculate alignment score of the following alignments using BLOSUM62 with gap opening of 10 and gap extension of 0.5. Also specify the type of alignment. 2.1 FTFTALILLAVAV Alignment type: # Global alignment F--TAL-LLA-AV Alignment score: # (6+5+(7*4))-(10*3)-(0.5*4) = FTALILL-AV Alignment type: # Local alignment FTAL-LLAAV Alignment score: # (6+5+(7*4))-(10*1)-(0.5*1) = Follow steps shown below to align cxea gene of Dictyostelium discoideum AX4 strain to its cdna sequence. 1) Go to the EBI website ( 2

3 2) Under the local alignment section, choose program Water > Nucleotide 3) Copy both DNA and cdna sequence of cxea gene of Dictyostelium discoideum AX4 strain, and then paste on the box as shown below. 4) Take a look at all parameters used for performing pairwise sequence alignment using Smith-Waterman algorithm (local sequence alignment). 3

4 Parameters: Matrix, Gap opening and Gap extension 5) Click submit and wait until you see the result as follows Summary result 6) You can copy the result in a new notepad and save it as a text file (.txt). Based on the alignment result, how many exons does the cxea gene in Dictyostelium discoideum AX4 strain carry? # This sequence contained 2 exons. The alignment result was saved in the file named Ddiscoidium_cxeA_alingment.txt. You can use Aliview to view the alignment 4

5 If you perform this analysis using global sequence alignment, will you obtain the same result as that provided by the local sequence alignment? # The results are the same because the regions containing matched residues are identical. How could you verify that your predicted number of exons is correct? # There are a number of ways you can used to verify the predicted number of exon; for example, you can translate the concatenated exons and compare the translated nucleotide sequence to the protein database sequence, then check whether the most similar protein is the cxea protein or not. 4. Use the pairwise sequence alignment method to align sequence of the E gene of DENV-3 to that of DENV-4. The steps to perform global sequence alignment are shown below. 1) Go to the EBI website ( 2) Under the global alignment section, choose program Needle > Nucleotide 3) Copy DNA sequence of DENV-3 and DENV-4, then paste on the box as shown below. 5

6 4) Take a look at all parameters used for performing pairwise sequence alignment using Needle-W algorithm (global sequence alignment). Parameters: Matrix, Gap opening and Gap extension Extra parameter: End gap penalty 5) Click submit and wait until you see the result as follows. 6

7 Summary result 6) You can copy the result in a new notepad and save it as a text file (.txt). Based on the alignment result, how much are the similarity of the DNA sequences between the E gene of dengue virus serotype 3 (DENV-3) and E gene of dengue virus serotype 4 (DENV-4)? # In case of nucleotide sequence, percent similarity is the same as percent identity which in this case is 65%. How could you evaluate whether this alignment is correct or not? # You can align amino acid sequences in addition to the nucleotide sequence alignment, then compare the amino acid sequence alignment to the translated nucleotide sequence alignment. We have done this task when we practice section no Follow the steps shown below to locate the envelope protein domain Iii on the envelope protein sequence of the dengue virus serotype 3 (DENV-3). 1) Go to the EBI website ( 7

8 2) Under the local alignment section, choose program Water > Protein 3) Copy amino acid sequence of DENV-3 envelope protein and the envelope protein domain Iii, then paste on the box as shown below. 4) Take a look at all parameters used for performing pairwise sequence alignment using Needle-W algorithm (global sequence alignment). 8

9 Parameters: Matrix, Gap opening and Gap extension 5) Click submit and wait until you see the result as follows. Summary result 6) You can copy the result in a new notepad and save it as a text file (.txt). Where is the envelope protein domain Iii on the DENV-3 envelope protein? Please answer this question by stating the amino acid positions on the DENV-3 envelope protein. # Based on the result shown above, the envelope protein domain Iii is located from amino acid 290 to

10 6. Align E gene and envelope protein sequences of dengue virus (DENV-1,2,3 and 4) using G-INS-i in MAFFT. Follow the steps below to align nucleotide sequences. 1) Go to the to download program Aliview. This program will be used to view aligned sequences. Please read install instruction on the website. 10 2) Follow the link here to the MAFFT website.

11 3) Choose to perform Alignment. This function is located on the left-handed side menu as follow. 4) After clicking the Alignment, copy DNA sequences of the DENV-1 to 4 and paste to the box as follows. 5) Set parameter values as follows. Any hidden option/parameter was left as default setting. 11

12 12 6) Click submit. After a while, you will see the alignment result as follows.

13 This alignment is in clustal format. 7) Click Fasta format, then you will see the alignment in fasta format. Copy the alignment and paste on a new notepad, then save the alignment file as a text with extension.txt or.fasta. 8) Open the program Aliview. Click File > Open file, then choose your alignment file. You will see the alignment as follows. 13

14 Click as follows. These steps will translate you DNA sequence to amino acid sequence alignment. Make sure that you choose Standard code and Reading frame ) You can apply these steps to align envelope protein sequences of these dengue viruses. After aligning the protein sequences, save the result in a fasta format. 10) Compare the amino acid sequence alignment obtained from step 9) to the translated nucleotide sequence alignment obtained from step 8). Manually correct your DNA sequence alignment based on the amino acid sequence alignment. How many positions in the DNA sequence alignment do you need to edit in order to correct the DNA sequence alignment? # After comparing amino acid to nucleotide sequence alignment, you would see that you need to move nucleotide from position 471 to 465. The alignment would change from Fig.1 to Fig.2 as follows which after translation, the alignment would look just like the amino acid sequence alignment. Fig. 1 Fig. 2 14

15 7. Apply sequence alignment technique to answer the following questions. Explain how you align sequences by informing what method and options/parameters you have chosen. If the alignment needs to be manually edited, please state that the result obtained from the manually edited alignment. 7.1 How many exons are there in the luciferase gene of Luciola lateralis? # I performed a local pairwise sequence alignment using EMBOSS Water with default parameter values shown as follows. The result showed that this gene contains 7 exons. The alignment result is saved in the file named Luciferase_local_alignment.pdf. 7.2 Where are the conserved regions in the mtcoi gene of fireflies? Until recently, there are six complete mtgenome sequences of fireflies: Asymmetricata circumdata, Bicellonychia lividipennis, Luciola substriata, Aquatica leii, Luciola cruciate, Pyrocoelia rufa, that are available in the GenBank database. The mtcoi sequence of Rhagophthalmus lufengensis was used as an outgroup here. Answer this question by writing down the alignment of the longest conserved region observed in the alignment. # I performed multiple sequence alignment using MAFFT with option Auto and default parameter values. The alignment at the 3 end needs to be edit and the alignment at the 3 end would change from as shown in Fig.1 to that as shown in Fig. 2 Fig. 1 Fig. 2 The longest conserved region is located from position 340 to position 348 as follows. 15

Lab 4: Multiple Sequence Alignment (MSA)

Lab 4: Multiple Sequence Alignment (MSA) Lab 4: Multiple Sequence Alignment (MSA) The objective of this lab is to become familiar with the features of several multiple alignment and visualization tools, including the data input and output, basic

More information

Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA.

Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence or library of DNA. Fasta is used to compare a protein or DNA sequence to all of the

More information

Today s Lecture. Multiple sequence alignment. Improved scoring of pairwise alignments. Affine gap penalties Profiles

Today s Lecture. Multiple sequence alignment. Improved scoring of pairwise alignments. Affine gap penalties Profiles Today s Lecture Multiple sequence alignment Improved scoring of pairwise alignments Affine gap penalties Profiles 1 The Edit Graph for a Pair of Sequences G A C G T T G A A T G A C C C A C A T G A C G

More information

FASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm.

FASTA. Besides that, FASTA package provides SSEARCH, an implementation of the optimal Smith- Waterman algorithm. FASTA INTRODUCTION Definition (by David J. Lipman and William R. Pearson in 1985) - Compares a sequence of protein to another sequence or database of a protein, or a sequence of DNA to another sequence

More information

Principles of Bioinformatics. BIO540/STA569/CSI660 Fall 2010

Principles of Bioinformatics. BIO540/STA569/CSI660 Fall 2010 Principles of Bioinformatics BIO540/STA569/CSI660 Fall 2010 Lecture 11 Multiple Sequence Alignment I Administrivia Administrivia The midterm examination will be Monday, October 18 th, in class. Closed

More information

Database Searching Using BLAST

Database Searching Using BLAST Mahidol University Objectives SCMI512 Molecular Sequence Analysis Database Searching Using BLAST Lecture 2B After class, students should be able to: explain the FASTA algorithm for database searching explain

More information

Bioinformatics for Biologists

Bioinformatics for Biologists Bioinformatics for Biologists Sequence Analysis: Part I. Pairwise alignment and database searching Fran Lewitter, Ph.D. Director Bioinformatics & Research Computing Whitehead Institute Topics to Cover

More information

Basic Local Alignment Search Tool (BLAST)

Basic Local Alignment Search Tool (BLAST) BLAST 26.04.2018 Basic Local Alignment Search Tool (BLAST) BLAST (Altshul-1990) is an heuristic Pairwise Alignment composed by six-steps that search for local similarities. The most used access point to

More information

.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar..

.. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. .. Fall 2011 CSC 570: Bioinformatics Alexander Dekhtyar.. PAM and BLOSUM Matrices Prepared by: Jason Banich and Chris Hoover Background As DNA sequences change and evolve, certain amino acids are more

More information

Data Walkthrough: Background

Data Walkthrough: Background Data Walkthrough: Background File Types FASTA Files FASTA files are text-based representations of genetic information. They can contain nucleotide or amino acid sequences. For this activity, students will

More information

Global Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties

Global Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties Global Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties From LCS to Alignment: Change the Scoring The Longest Common Subsequence (LCS) problem the simplest form of sequence

More information

PROTEIN MULTIPLE ALIGNMENT MOTIVATION: BACKGROUND: Marina Sirota

PROTEIN MULTIPLE ALIGNMENT MOTIVATION: BACKGROUND: Marina Sirota Marina Sirota MOTIVATION: PROTEIN MULTIPLE ALIGNMENT To study evolution on the genetic level across a wide range of organisms, biologists need accurate tools for multiple sequence alignment of protein

More information

A multiple alignment tool in 3D

A multiple alignment tool in 3D Outline Department of Computer Science, Bioinformatics Group University of Leipzig TBI Winterseminar Bled, Slovenia February 2005 Outline Outline 1 Multiple Alignments Problems Goal Outline Outline 1 Multiple

More information

Heuristic methods for pairwise alignment:

Heuristic methods for pairwise alignment: Bi03c_1 Unit 03c: Heuristic methods for pairwise alignment: k-tuple-methods k-tuple-methods for alignment of pairs of sequences Bi03c_2 dynamic programming is too slow for large databases Use heuristic

More information

CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment

CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment CISC 889 Bioinformatics (Spring 2003) Multiple Sequence Alignment Courtesy of jalview 1 Motivations Collective statistic Protein families Identification and representation of conserved sequence features

More information

BLAST, Profile, and PSI-BLAST

BLAST, Profile, and PSI-BLAST BLAST, Profile, and PSI-BLAST Jianlin Cheng, PhD School of Electrical Engineering and Computer Science University of Central Florida 26 Free for academic use Copyright @ Jianlin Cheng & original sources

More information

Sequence analysis Pairwise sequence alignment

Sequence analysis Pairwise sequence alignment UMF11 Introduction to bioinformatics, 25 Sequence analysis Pairwise sequence alignment 1. Sequence alignment Lecturer: Marina lexandersson 12 September, 25 here are two types of sequence alignments, global

More information

Biology 644: Bioinformatics

Biology 644: Bioinformatics Find the best alignment between 2 sequences with lengths n and m, respectively Best alignment is very dependent upon the substitution matrix and gap penalties The Global Alignment Problem tries to find

More information

Alignment of Pairs of Sequences

Alignment of Pairs of Sequences Bi03a_1 Unit 03a: Alignment of Pairs of Sequences Partners for alignment Bi03a_2 Protein 1 Protein 2 =amino-acid sequences (20 letter alphabeth + gap) LGPSSKQTGKGS-SRIWDN LN-ITKSAGKGAIMRLGDA -------TGKG--------

More information

Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014

Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic Programming User Manual v1.0 Anton E. Weisstein, Truman State University Aug. 19, 2014 Dynamic programming is a group of mathematical methods used to sequentially split a complicated problem into

More information

Multiple Sequence Alignment. Mark Whitsitt - NCSA

Multiple Sequence Alignment. Mark Whitsitt - NCSA Multiple Sequence Alignment Mark Whitsitt - NCSA What is a Multiple Sequence Alignment (MA)? GMHGTVYANYAVDSSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPHV GMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHV

More information

CS313 Exercise 4 Cover Page Fall 2017

CS313 Exercise 4 Cover Page Fall 2017 CS313 Exercise 4 Cover Page Fall 2017 Due by the start of class on Thursday, October 12, 2017. Name(s): In the TIME column, please estimate the time you spent on the parts of this exercise. Please try

More information

Sequence alignment algorithms

Sequence alignment algorithms Sequence alignment algorithms Bas E. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 23 rd 27 After this lecture, you can decide when to use local and global sequence alignments

More information

Algorithmic Approaches for Biological Data, Lecture #20

Algorithmic Approaches for Biological Data, Lecture #20 Algorithmic Approaches for Biological Data, Lecture #20 Katherine St. John City University of New York American Museum of Natural History 20 April 2016 Outline Aligning with Gaps and Substitution Matrices

More information

Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD

Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Lecture 2 Pairwise sequence alignment. Principles Computational Biology Teresa Przytycka, PhD Assumptions: Biological sequences evolved by evolution. Micro scale changes: For short sequences (e.g. one

More information

Salvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón

Salvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón trimal: a tool for automated alignment trimming in large-scale phylogenetics analyses Salvador Capella-Gutiérrez, Jose M. Silla-Martínez and Toni Gabaldón Version 1.2b Index of contents 1. General features

More information

Programming assignment for the course Sequence Analysis (2006)

Programming assignment for the course Sequence Analysis (2006) Programming assignment for the course Sequence Analysis (2006) Original text by John W. Romein, adapted by Bart van Houte (bart@cs.vu.nl) Introduction Please note: This assignment is only obligatory for

More information

Similarity Searches on Sequence Databases

Similarity Searches on Sequence Databases Similarity Searches on Sequence Databases Lorenza Bordoli Swiss Institute of Bioinformatics EMBnet Course, Zürich, October 2004 Swiss Institute of Bioinformatics Swiss EMBnet node Outline Importance of

More information

As of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be

As of August 15, 2008, GenBank contained bases from reported sequences. The search procedure should be 48 Bioinformatics I, WS 09-10, S. Henz (script by D. Huson) November 26, 2009 4 BLAST and BLAT Outline of the chapter: 1. Heuristics for the pairwise local alignment of two sequences 2. BLAST: search and

More information

Biostatistics and Bioinformatics Molecular Sequence Databases

Biostatistics and Bioinformatics Molecular Sequence Databases . 1 Description of Module Subject Name Paper Name Module Name/Title 13 03 Dr. Vijaya Khader Dr. MC Varadaraj 2 1. Objectives: In the present module, the students will learn about 1. Encoding linear sequences

More information

BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences

BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences BIOL591: Introduction to Bioinformatics Alignment of pairs of sequences Reading in text (Mount Bioinformatics): I must confess that the treatment in Mount of sequence alignment does not seem to me a model

More information

Bioinformatics explained: Smith-Waterman

Bioinformatics explained: Smith-Waterman Bioinformatics Explained Bioinformatics explained: Smith-Waterman May 1, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com

More information

Introduction to Phylogenetics Week 2. Databases and Sequence Formats

Introduction to Phylogenetics Week 2. Databases and Sequence Formats Introduction to Phylogenetics Week 2 Databases and Sequence Formats I. Databases Crucial to bioinformatics The bigger the database, the more comparative research data Requires scientists to upload data

More information

Homology Modeling FABP

Homology Modeling FABP Homology Modeling FABP Homology modeling is a technique used to approximate the 3D structure of a protein when no experimentally determined structure exists. It operates under the principle that protein

More information

Computational Genomics and Molecular Biology, Fall

Computational Genomics and Molecular Biology, Fall Computational Genomics and Molecular Biology, Fall 2015 1 Sequence Alignment Dannie Durand Pairwise Sequence Alignment The goal of pairwise sequence alignment is to establish a correspondence between the

More information

In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace.

In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace. 5 Multiple Match Refinement and T-Coffee In this section we describe how to extend the match refinement to the multiple case and then use T-Coffee to heuristically compute a multiple trace. This exposition

More information

Wilson Leung 01/03/2018 An Introduction to NCBI BLAST. Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment

Wilson Leung 01/03/2018 An Introduction to NCBI BLAST. Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment An Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at https://blast.ncbi.nlm.nih.gov/blast.cgi

More information

CMSC 423 Fall 2009: Project Specification

CMSC 423 Fall 2009: Project Specification CMSC 423 Fall 2009: Project Specification Introduction The project will consist of four components due throughout the semester (see below for timeline). Basic rules: You are allowed to work in teams of

More information

Lecture 5 Advanced BLAST

Lecture 5 Advanced BLAST Introduction to Bioinformatics for Medical Research Gideon Greenspan gdg@cs.technion.ac.il Lecture 5 Advanced BLAST BLAST Recap Sequence Alignment Complexity and indexing BLASTN and BLASTP Basic parameters

More information

Submitting allele sequences to the GenBank NGSengine allele submission Sequin

Submitting allele sequences to the GenBank NGSengine allele submission Sequin 1 Submitting allele sequences to the GenBank 1 2 NGSengine allele submission 1 2.1 NGSengine restrictions 1 2.2 Allele names 2 2.3 Generating the fasta file and feature table 2 3 Sequin 2 3.1 Generating

More information

BLAST MCDB 187. Friday, February 8, 13

BLAST MCDB 187. Friday, February 8, 13 BLAST MCDB 187 BLAST Basic Local Alignment Sequence Tool Uses shortcut to compute alignments of a sequence against a database very quickly Typically takes about a minute to align a sequence against a database

More information

ICB Fall G4120: Introduction to Computational Biology. Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology

ICB Fall G4120: Introduction to Computational Biology. Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology ICB Fall 2008 G4120: Computational Biology Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology Copyright 2008 Oliver Jovanovic, All Rights Reserved. The Digital Language of Computers

More information

Similarity searches in biological sequence databases

Similarity searches in biological sequence databases Similarity searches in biological sequence databases Volker Flegel september 2004 Page 1 Outline Keyword search in databases General concept Examples SRS Entrez Expasy Similarity searches in databases

More information

CAP BLAST. BIOINFORMATICS Su-Shing Chen CISE. 8/20/2005 Su-Shing Chen, CISE 1

CAP BLAST. BIOINFORMATICS Su-Shing Chen CISE. 8/20/2005 Su-Shing Chen, CISE 1 CAP 5510-6 BLAST BIOINFORMATICS Su-Shing Chen CISE 8/20/2005 Su-Shing Chen, CISE 1 BLAST Basic Local Alignment Prof Search Su-Shing Chen Tool A Fast Pair-wise Alignment and Database Searching Tool 8/20/2005

More information

Biochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA)

Biochemistry 324 Bioinformatics. Multiple Sequence Alignment (MSA) Biochemistry 324 Bioinformatics Multiple Sequence Alignment (MSA) Big- Οh notation Greek omicron symbol Ο The Big-Oh notation indicates the complexity of an algorithm in terms of execution speed and storage

More information

A Design of a Hybrid System for DNA Sequence Alignment

A Design of a Hybrid System for DNA Sequence Alignment IMECS 2008, 9-2 March, 2008, Hong Kong A Design of a Hybrid System for DNA Sequence Alignment Heba Khaled, Hossam M. Faheem, Tayseer Hasan, Saeed Ghoneimy Abstract This paper describes a parallel algorithm

More information

Sequence alignment theory and applications Session 3: BLAST algorithm

Sequence alignment theory and applications Session 3: BLAST algorithm Sequence alignment theory and applications Session 3: BLAST algorithm Introduction to Bioinformatics online course : IBT Sonal Henson Learning Objectives Understand the principles of the BLAST algorithm

More information

An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST

An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST An Analysis of Pairwise Sequence Alignment Algorithm Complexities: Needleman-Wunsch, Smith-Waterman, FASTA, BLAST and Gapped BLAST Alexander Chan 5075504 Biochemistry 218 Final Project An Analysis of Pairwise

More information

Tutorial 4 BLAST Searching the CHO Genome

Tutorial 4 BLAST Searching the CHO Genome Tutorial 4 BLAST Searching the CHO Genome Accessing the CHO Genome BLAST Tool The CHO BLAST server can be accessed by clicking on the BLAST button on the home page or by selecting BLAST from the menu bar

More information

Pairwise Sequence Alignment: Dynamic Programming Algorithms. COMP Spring 2015 Luay Nakhleh, Rice University

Pairwise Sequence Alignment: Dynamic Programming Algorithms. COMP Spring 2015 Luay Nakhleh, Rice University Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 - Spring 2015 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment The number of all possible pairwise alignments (if

More information

BLAST - Basic Local Alignment Search Tool

BLAST - Basic Local Alignment Search Tool Lecture for ic Bioinformatics (DD2450) April 11, 2013 Searching 1. Input: Query Sequence 2. Database of sequences 3. Subject Sequence(s) 4. Output: High Segment Pairs (HSPs) Sequence Similarity Measures:

More information

Multiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences

Multiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences Multiple Sequence Alignment Based on Profile Alignment of Intermediate Sequences Yue Lu and Sing-Hoi Sze RECOMB 2007 Presented by: Wanxing Xu March 6, 2008 Content Biology Motivation Computation Problem

More information

Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University

Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University 1 Pairwise Sequence Alignment: Dynamic Programming Algorithms COMP 571 Luay Nakhleh, Rice University DP Algorithms for Pairwise Alignment 2 The number of all possible pairwise alignments (if gaps are allowed)

More information

B L A S T! BLAST: Basic local alignment search tool. Copyright notice. February 6, Pairwise alignment: key points. Outline of tonight s lecture

B L A S T! BLAST: Basic local alignment search tool. Copyright notice. February 6, Pairwise alignment: key points. Outline of tonight s lecture February 6, 2008 BLAST: Basic local alignment search tool B L A S T! Jonathan Pevsner, Ph.D. Introduction to Bioinformatics pevsner@jhmi.edu 4.633.0 Copyright notice Many of the images in this powerpoint

More information

CMSC423: Bioinformatic Algorithms, Databases and Tools Lecture 8. Note

CMSC423: Bioinformatic Algorithms, Databases and Tools Lecture 8. Note MS: Bioinformatic lgorithms, Databases and ools Lecture 8 Sequence alignment: inexact alignment dynamic programming, gapped alignment Note Lecture 7 suffix trees and suffix arrays will be rescheduled Exact

More information

Bioinformatics explained: BLAST. March 8, 2007

Bioinformatics explained: BLAST. March 8, 2007 Bioinformatics Explained Bioinformatics explained: BLAST March 8, 2007 CLC bio Gustav Wieds Vej 10 8000 Aarhus C Denmark Telephone: +45 70 22 55 09 Fax: +45 70 22 55 19 www.clcbio.com info@clcbio.com Bioinformatics

More information

Lecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations:

Lecture Overview. Sequence search & alignment. Searching sequence databases. Sequence Alignment & Search. Goals: Motivations: Lecture Overview Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating

More information

Jyoti Lakhani 1, Ajay Khunteta 2, Dharmesh Harwani *3 1 Poornima University, Jaipur & Maharaja Ganga Singh University, Bikaner, Rajasthan, India

Jyoti Lakhani 1, Ajay Khunteta 2, Dharmesh Harwani *3 1 Poornima University, Jaipur & Maharaja Ganga Singh University, Bikaner, Rajasthan, India International Journal of Scientific Research in Computer Science, Engineering and Information Technology 2017 IJSRCSEIT Volume 2 Issue 6 ISSN : 2456-3307 Improvisation of Global Pairwise Sequence Alignment

More information

Pairwise Sequence Alignment. Zhongming Zhao, PhD

Pairwise Sequence Alignment. Zhongming Zhao, PhD Pairwise Sequence Alignment Zhongming Zhao, PhD Email: zhongming.zhao@vanderbilt.edu http://bioinfo.mc.vanderbilt.edu/ Sequence Similarity match mismatch A T T A C G C G T A C C A T A T T A T G C G A T

More information

Dynamic Programming & Smith-Waterman algorithm

Dynamic Programming & Smith-Waterman algorithm m m Seminar: Classical Papers in Bioinformatics May 3rd, 2010 m m 1 2 3 m m Introduction m Definition is a method of solving problems by breaking them down into simpler steps problem need to contain overlapping

More information

EECS 4425: Introductory Computational Bioinformatics Fall Suprakash Datta

EECS 4425: Introductory Computational Bioinformatics Fall Suprakash Datta EECS 4425: Introductory Computational Bioinformatics Fall 2018 Suprakash Datta datta [at] cse.yorku.ca Office: CSEB 3043 Phone: 416-736-2100 ext 77875 Course page: http://www.cse.yorku.ca/course/4425 Many

More information

Sequence Alignment & Search

Sequence Alignment & Search Sequence Alignment & Search Karin Verspoor, Ph.D. Faculty, Computational Bioscience Program University of Colorado School of Medicine With credit and thanks to Larry Hunter for creating the first version

More information

Sequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC--

Sequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC-- Sequence Alignment Sequence Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC-- TAG-CTATCAC--GACCGC--GGTCGATTTGCCCGAC Distance from sequences

More information

Page 1.1 Guidelines 2 Requirements JCoDA package Input file formats License. 1.2 Java Installation 3-4 Not required in all cases

Page 1.1 Guidelines 2 Requirements JCoDA package Input file formats License. 1.2 Java Installation 3-4 Not required in all cases JCoDA and PGI Tutorial Version 1.0 Date 03/16/2010 Page 1.1 Guidelines 2 Requirements JCoDA package Input file formats License 1.2 Java Installation 3-4 Not required in all cases 2.1 dn/ds calculation

More information

Lecture 10. Sequence alignments

Lecture 10. Sequence alignments Lecture 10 Sequence alignments Alignment algorithms: Overview Given a scoring system, we need to have an algorithm for finding an optimal alignment for a pair of sequences. We want to maximize the score

More information

3.4 Multiple sequence alignment

3.4 Multiple sequence alignment 3.4 Multiple sequence alignment Why produce a multiple sequence alignment? Using more than two sequences results in a more convincing alignment by revealing conserved regions in ALL of the sequences Aligned

More information

Finding Selection in All the Right Places TA Notes and Key Lab 9

Finding Selection in All the Right Places TA Notes and Key Lab 9 Objectives: Finding Selection in All the Right Places TA Notes and Key Lab 9 1. Use published genome data to look for evidence of selection in individual genes. 2. Understand the need for DNA sequence

More information

EBI services. Jennifer McDowall EMBL-EBI

EBI services. Jennifer McDowall EMBL-EBI EBI services Jennifer McDowall EMBL-EBI The SLING project is funded by the European Commission within Research Infrastructures of the FP7 Capacities Specific Programme, grant agreement number 226073 (Integrating

More information

Finding homologous sequences in databases

Finding homologous sequences in databases Finding homologous sequences in databases There are multiple algorithms to search sequences databases BLAST (EMBL, NCBI, DDBJ, local) FASTA (EMBL, local) For protein only databases scan via Smith-Waterman

More information

Computational Molecular Biology

Computational Molecular Biology Computational Molecular Biology Erwin M. Bakker Lecture 2 Materials used from R. Shamir [2] and H.J. Hoogeboom [4]. 1 Molecular Biology Sequences DNA A, T, C, G RNA A, U, C, G Protein A, R, D, N, C E,

More information

Wilson Leung 05/27/2008 A Simple Introduction to NCBI BLAST

Wilson Leung 05/27/2008 A Simple Introduction to NCBI BLAST A Simple Introduction to NCBI BLAST Prerequisites: Detecting and Interpreting Genetic Homology: Lecture Notes on Alignment Resources: The BLAST web server is available at http://www.ncbi.nih.gov/blast/

More information

Notes on Dynamic-Programming Sequence Alignment

Notes on Dynamic-Programming Sequence Alignment Notes on Dynamic-Programming Sequence Alignment Introduction. Following its introduction by Needleman and Wunsch (1970), dynamic programming has become the method of choice for rigorous alignment of DNA

More information

Lecture 4: January 1, Biological Databases and Retrieval Systems

Lecture 4: January 1, Biological Databases and Retrieval Systems Algorithms for Molecular Biology Fall Semester, 1998 Lecture 4: January 1, 1999 Lecturer: Irit Orr Scribe: Irit Gat and Tal Kohen 4.1 Biological Databases and Retrieval Systems In recent years, biological

More information

Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it.

Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it. Sequence Alignments Overview Sequence alignment is an essential concept for bioinformatics, as most of our data analysis and interpretation techniques make use of it. Sequence alignment means arranging

More information

BIR pipeline steps and subsequent output files description STEP 1: BLAST search

BIR pipeline steps and subsequent output files description STEP 1: BLAST search Lifeportal (Brief description) The Lifeportal at University of Oslo (https://lifeportal.uio.no) is a Galaxy based life sciences portal lifeportal.uio.no under the UiO tools section for phylogenomic analysis,

More information

Filogeografía BIOL 4211, Universidad de los Andes 25 de enero a 01 de abril 2006

Filogeografía BIOL 4211, Universidad de los Andes 25 de enero a 01 de abril 2006 Laboratory excercise written by Andrew J. Crawford with the support of CIES Fulbright Program and Fulbright Colombia. Enjoy! Filogeografía BIOL 4211, Universidad de los Andes 25 de enero

More information

EECS730: Introduction to Bioinformatics

EECS730: Introduction to Bioinformatics EECS730: Introduction to Bioinformatics Lecture 04: Variations of sequence alignments http://www.pitt.edu/~mcs2/teaching/biocomp/tutorials/global.html Slides adapted from Dr. Shaojie Zhang (University

More information

Sequence Alignment. GBIO0002 Archana Bhardwaj University of Liege

Sequence Alignment. GBIO0002 Archana Bhardwaj University of Liege Sequence Alignment GBIO0002 Archana Bhardwaj University of Liege 1 What is Sequence Alignment? A sequence alignment is a way of arranging the sequences of DNA, RNA, or protein to identify regions of similarity.

More information

COMPARATIVE MICROBIAL GENOMICS ANALYSIS WORKSHOP. Exercise 2: Predicting Protein-encoding Genes, BlastMatrix, BlastAtlas

COMPARATIVE MICROBIAL GENOMICS ANALYSIS WORKSHOP. Exercise 2: Predicting Protein-encoding Genes, BlastMatrix, BlastAtlas COMPARATIVE MICROBIAL GENOMICS ANALYSIS WORKSHOP Exercise 2: Predicting Protein-encoding Genes, BlastMatrix, BlastAtlas First of all connect once again to the CBS system: Open ssh shell client. Press Quick

More information

Bioinformatics. Sequence alignment BLAST Significance. Next time Protein Structure

Bioinformatics. Sequence alignment BLAST Significance. Next time Protein Structure Bioinformatics Sequence alignment BLAST Significance Next time Protein Structure 1 Experimental origins of sequence data The Sanger dideoxynucleotide method F Each color is one lane of an electrophoresis

More information

CS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores.

CS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores. CS 284A: Algorithms for Computational Biology Notes on Lecture: BLAST. The statistics of alignment scores. prepared by Oleksii Kuchaiev, based on presentation by Xiaohui Xie on February 20th. 1 Introduction

More information

Profiles and Multiple Alignments. COMP 571 Luay Nakhleh, Rice University

Profiles and Multiple Alignments. COMP 571 Luay Nakhleh, Rice University Profiles and Multiple Alignments COMP 571 Luay Nakhleh, Rice University Outline Profiles and sequence logos Profile hidden Markov models Aligning profiles Multiple sequence alignment by gradual sequence

More information

Sequence Alignment. part 2

Sequence Alignment. part 2 Sequence Alignment part 2 Dynamic programming with more realistic scoring scheme Using the same initial sequences, we ll look at a dynamic programming example with a scoring scheme that selects for matches

More information

Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion.

Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. www.ijarcet.org 54 Acceleration of Algorithm of Smith-Waterman Using Recursive Variable Expansion. Hassan Kehinde Bello and Kazeem Alagbe Gbolagade Abstract Biological sequence alignment is becoming popular

More information

INTRODUCTION TO BIOINFORMATICS

INTRODUCTION TO BIOINFORMATICS Molecular Biology-2017 1 INTRODUCTION TO BIOINFORMATICS In this section, we want to provide a simple introduction to using the web site of the National Center for Biotechnology Information NCBI) to obtain

More information

Dynamic Programming: Sequence alignment. CS 466 Saurabh Sinha

Dynamic Programming: Sequence alignment. CS 466 Saurabh Sinha Dynamic Programming: Sequence alignment CS 466 Saurabh Sinha DNA Sequence Comparison: First Success Story Finding sequence similarities with genes of known function is a common approach to infer a newly

More information

Shortest Path Algorithm

Shortest Path Algorithm Shortest Path Algorithm C Works just fine on this graph. C Length of shortest path = Copyright 2005 DIMACS BioMath Connect Institute Robert Hochberg Dynamic Programming SP #1 Same Questions, Different

More information

Lecture 10: Local Alignments

Lecture 10: Local Alignments Lecture 10: Local Alignments Study Chapter 6.8-6.10 1 Outline Edit Distances Longest Common Subsequence Global Sequence Alignment Scoring Matrices Local Sequence Alignment Alignment with Affine Gap Penalties

More information

BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha

BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio. 1990. CS 466 Saurabh Sinha Motivation Sequence homology to a known protein suggest function of newly sequenced protein Bioinformatics

More information

Today s Lecture. Edit graph & alignment algorithms. Local vs global Computational complexity of pairwise alignment Multiple sequence alignment

Today s Lecture. Edit graph & alignment algorithms. Local vs global Computational complexity of pairwise alignment Multiple sequence alignment Today s Lecture Edit graph & alignment algorithms Smith-Waterman algorithm Needleman-Wunsch algorithm Local vs global Computational complexity of pairwise alignment Multiple sequence alignment 1 Sequence

More information

Machine Learning. Computational biology: Sequence alignment and profile HMMs

Machine Learning. Computational biology: Sequence alignment and profile HMMs 10-601 Machine Learning Computational biology: Sequence alignment and profile HMMs Central dogma DNA CCTGAGCCAACTATTGATGAA transcription mrna CCUGAGCCAACUAUUGAUGAA translation Protein PEPTIDE 2 Growth

More information

SWAMP: Smith-Waterman using Associative Massive Parallelism

SWAMP: Smith-Waterman using Associative Massive Parallelism SWAMP: Smith-Waterman using Associative Massive Parallelism Shannon Steinfadt Dr. Johnnie W. Baker Department of Computer Science, Kent State University, Kent, Ohio 44242 USA ssteinfa@cs.kent.edu jbaker@cs.kent.edu

More information

A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity

A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity A Study On Pair-Wise Local Alignment Of Protein Sequence For Identifying The Structural Similarity G. Pratyusha, Department of Computer Science & Engineering, V.R.Siddhartha Engineering College(Autonomous)

More information

GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment

GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment GLOBEX Bioinformatics (Summer 2015) Multiple Sequence Alignment Scoring Dynamic Programming algorithms Heuristic algorithms CLUSTAL W Courtesy of jalview Motivations Collective (or aggregate) statistic

More information

24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading:

24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, This lecture is based on the following papers, which are all recommended reading: 24 Grundlagen der Bioinformatik, SS 10, D. Huson, April 26, 2010 3 BLAST and FASTA This lecture is based on the following papers, which are all recommended reading: D.J. Lipman and W.R. Pearson, Rapid

More information

Mouse, Human, Chimpanzee

Mouse, Human, Chimpanzee More Alignments 1 Mouse, Human, Chimpanzee Mouse to Human Chimpanzee to Human 2 Mouse v.s. Human Chromosome X of Mouse to Human 3 Local Alignment Given: two sequences S and T Find: substrings of S and

More information

VectorBase Web Apollo April Web Apollo 1

VectorBase Web Apollo April Web Apollo 1 Web Apollo 1 Contents 1. Access points: Web Apollo, Genome Browser and BLAST 2. How to identify genes that need to be annotated? 3. Gene manual annotations 4. Metadata 1. Access points Web Apollo tool

More information

One report (in pdf format) addressing each of following questions.

One report (in pdf format) addressing each of following questions. MSCBIO 2070/02-710: Computational Genomics, Spring 2016 HW1: Sequence alignment and Evolution Due: 24:00 EST, Feb 15, 2016 by autolab Your goals in this assignment are to 1. Complete a genome assembler

More information

AlignMe Manual. Version 1.1. Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest

AlignMe Manual. Version 1.1. Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest AlignMe Manual Version 1.1 Rene Staritzbichler, Marcus Stamm, Kamil Khafizov and Lucy R. Forrest Max Planck Institute of Biophysics Frankfurt am Main 60438 Germany 1) Introduction...3 2) Using AlignMe

More information

Multiple Sequence Alignment Theory and Applications

Multiple Sequence Alignment Theory and Applications Mahidol University Objectives SMI512 Molecular Sequence alysis Multiple Sequence lignment Theory and pplications Lecture 3 Pravech jawatanawong, Ph.. e-mail: pravech.aja@mahidol.edu epartment of Microbiology

More information